KEGG   Trichodesmium erythraeum: Tery_1380Help
Entry
Tery_1380         CDS       T00387                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00010  Glycolysis / Gluconeogenesis
ter00051  Fructose and mannose metabolism
ter00562  Inositol phosphate metabolism
ter00710  Carbon fixation in photosynthetic organisms
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01120  Microbial metabolism in diverse environments
ter01130  Biosynthesis of antibiotics
ter01200  Carbon metabolism
ter01230  Biosynthesis of amino acids
Module
ter_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_1380
   00051 Fructose and mannose metabolism
    Tery_1380
   00562 Inositol phosphate metabolism
    Tery_1380
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tery_1380
Enzymes [BR:ter01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tery_1380
Exosome [BR:ter04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tery_1380
  Exosomal proteins of bladder cancer cells
   Tery_1380
  Exosomal proteins of melanoma cells
   Tery_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA
Motif
Other DBs
NCBI-ProteinID: ABG50687
CyanoBase: Tery_1380
CYORF: Tery_1380
UniProt: Q115Y7
Position
2113589..2114314
Genome map
AA seq 241 aa AA seqDB search
MRKTIIAGNWKMYKTQLEAKEFLEGLMSQLTKTPEEREVVLCTPFTALDFMSKILHGSLI
RLGAQNVHWEDEGAYTGEISGLMLKDVGVSYVIVGHSERRQYFGETDETVNMRLKAAQKH
GLTPILCVGETKQQRDSGETESHIFSQLANDLVDVDQENLVIAYEPIWAIGTGDTCEAKE
ANRVIGLIRGKLNNSNVTIQYGGSVKPNNVDDIMAQEEIDGALVGGASLNPESFSRLVNY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaactataattgctggtaattggaaaatgtacaagacccaactagaagctaaa
gagtttctcgagggtttgatgtctcaactaacaaaaacccccgaagaacgtgaagtagtt
ctctgcactcccttcacggcactagattttatgtcaaaaattttgcatgggagtctgatc
aggttaggtgcgcaaaatgttcactgggaagatgaaggagcatatacaggagaaatttct
ggcttaatgctgaaagatgtgggagttagttatgtaattgtgggtcacagtgagcgccgt
caatattttggcgaaactgatgaaacggtgaatatgcgcttaaaagctgctcagaagcac
ggtttaacccctattctctgtgtgggagaaactaaacaacaaagagattcaggtgagaca
gaatcacatatattttctcagttggccaatgatttagttgatgtcgatcaagaaaatcta
gtaattgcttatgaaccaatatgggccattggtactggtgatacctgtgaagctaaagaa
gctaaccgagttattggtttaattcgtggtaagttaaataattctaatgtcactattcaa
tatggcggttctgttaaacctaataatgttgatgatattatggcacaagaagaaattgat
ggtgctttagttgggggtgcaagtttgaatcccgagagttttagtcgtttggttaactat
caataa

DBGET integrated database retrieval system