KEGG   Trichodesmium erythraeum: Tery_1530Help
Entry
Tery_1530         CDS       T00387                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00860  Porphyrin and chlorophyll metabolism
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tery_1530
Enzymes [BR:ter01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Tery_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ABG50811
CyanoBase: Tery_1530
CYORF: Tery_1530
UniProt: Q115L3
Position
complement(2319290..2320687)
Genome map
AA seq 465 aa AA seqDB search
MSNTIQPEALTFECETGNYHTFCPISCVSWLYQKIEDSFFLVIGTKTCGYFLQNAMGVMI
FAEPRYAMAELEEGDISAKLNDYNELKRLCLQIKRDRNPSVIVWIGTCTTEIIKMDLEGL
APKLESEIGIPIVVARANGLDYAFTQGEDTVLAAMAARCPKQVLEVEKEAKNGIQKLLSF
GRKKEEVAAEKSEYVNHPPLILFGSLPDPVVTQLTLELKKQGIKVSGWLPAKHYTELPVI
EEGYYVAGVNPFLSRTATTLMRRRKCKLIGAPFPIGPDGSKAWIEKICSVFGIEPQGLVE
REEQIWNNLEDYIQLIRGKSVFFMGDNLLEISLARFLIRCGMTCPEIGIPYMDKRYQKAE
LEMLEKTCQEMGVRLPKIIEKPDNYNQIQRIYELQPDLVITGMAHANPLEARGINTKWSV
EFTFAQIHGFTNARDILELVTRPLRRNNALKDLGWDKLVKEEAKV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacgattcaacctgaagctttaacttttgagtgtgaaacaggtaattatcat
actttttgtccgattagttgtgtgtcttggctttatcaaaaaatagaagatagtttcttc
ttagtaataggtactaaaacctgtggttatttcctacaaaatgccatgggagtaatgatt
tttgctgaacctcgttatgctatggctgagttagaagaaggtgatatttcagctaagtta
aatgattataatgaactgaaacgtttatgtttacaaattaagcgtgacagaaaccccagt
gtcatagtctggattggcacttgtactactgaaattattaaaatggatttggaaggtttg
gctcctaaattagagtcagaaattggcattccaattgtggttgctcgtgctaatggtttg
gattatgcctttactcaaggggaagatacagttttagcagcaatggcagctcgttgtccg
aaacaagtcttagaagtagaaaaagaagcaaagaatggcatacaaaaactattaagtttt
ggcagaaaaaaggaggaagttgctgcagaaaaatctgagtatgttaaccatccacctttg
attttatttggttctttgccagacccagttgtcactcaattaactttagaattgaagaag
caaggaattaaggtttctggttggttgcctgctaaacattacacagaattaccagttatt
gaagagggatattatgtggcaggtgttaatcctttcttaagtcgtactgctactacttta
atgcgtcgtcggaagtgtaaattaattggtgcaccattccccataggtcctgatggaagt
aaggcttggattgaaaagatttgctctgtttttggtattgaacctcaaggtttggtagaa
agagaagagcaaatttggaataatttagaggactatattcaattaattcgtggtaagtct
gtcttttttatgggagataatttgttggagatttccttggctcgttttttgattcgttgt
ggtatgacttgcccagaaataggtattccttatatggataaaagatatcaaaaggctgag
ttggaaatgttggaaaaaacttgtcaggaaatgggtgtacgtttgccgaagattattgag
aaacctgataattataatcagattcaaagaatttatgaattacagccagatttggtaatt
actggtatggctcacgctaatcctttggaggcacgggggattaatactaagtggtcagtt
gagtttacttttgctcaaattcatgggtttacaaatgctcgtgatatcttggaattagta
actcgtcctttgcgtcgaaataatgctttgaaagatttaggttgggataagttagttaag
gaagaagctaaggtttaa

DBGET integrated database retrieval system