KEGG   Trichodesmium erythraeum: Tery_3629
Entry
Tery_3629         CDS       T00387                                 

Definition
(GenBank) ATPase, P-type (transporting), HAD superfamily, subfamily IC
  KO
K12952  cation-transporting P-type ATPase E [EC:7.2.2.-]
Organism
ter  Trichodesmium erythraeum
Brite
KEGG Orthology (KO) [BR:ter00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tery_3629
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 Cation_ATPase HAD_2
Other DBs
NCBI-ProteinID: ABG52697
CyanoBase: Tery_3629
CYORF: Tery_3629
UniProt: Q10YH7
Position
complement(5579819..5582314)
AA seq 831 aa
MNDRQNIHNTSIIHGLTKDQVINLRAVGRGNNIKLDTSRSYRQILKENLFTFINTVFLSI
SLVLISLSRYGDAFLVIIVILGGVIVSVCQEIWAKQKLDQIALLARPLATVIRETKQQNI
DPSEIVVGDILVVHSGDQIVVDGQVVGKGQIEVDESLLTGESDLVPKQAGQPVYSGSFCV
SGTAHYEAQKVGTESFAYQLTVSARAFRQIYTPLQQEINLVIRVFLLLSCFLWILVSINW
YFGFYKFVDTVQYAAVIAGLVPSGLYLAITLAYALGAVKMVGQEVLIQQANAVESLSNVD
ILCLDKTGTLTTNHISLQAIYPIGIDEIKLENILGEYAASTTSKNKTIEALERVFPRPKR
SLTFEIPFASARKWSGMSFATEEQNSPSGTYILGAPEILAEVTPLSRKFTQQIQKLAQKG
FRVLLFAYNPNISSLDQDLEKLQLPTELFPLGIISFQDELRPEARETIEGFSKVGIKIKV
ISGDNPQTVATLALQAGLSSNIQVISGSELAKLDEDQFIQAAKSKTIFGSVTPKQKAKLI
HSFKKQGHYVAMIGDGVNDVLSLKEANLAIAMEGGSKATRSVADIVLLNNSFASLPHTFL
EGQRIRNSIQDVLKLFMIRVFCVSILIFSTGFIGGFIGGTFPLLNKHSAVVTLISVGFPT
FCIPIWAKPGILPRRSMIRSLLHFTLPATFSLTLVALLVYLTYLAIPFSGNELVIDLDQV
NEFLSVPRSALVTIMILCGLLLVPFLKPPTKAWVGGETYSGDWRYTFVALALLGVYIVIL
AVPPLRQFFELSLLSTHDYLVIIWVALVWCLLLRYVWRTKLLDKFLGVDLS
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaatgatcgccaaaatattcacaatacctcaattattcacggtctcacaaaagaccaa
gtcataaatcttcgtgctgtcggtcgaggaaataatatcaaactagacacaagtcgctcc
taccgccagatattaaaagaaaacttatttacctttattaataccgttttccttagcatt
agcctagttttaatttctctttctcgttatggtgatgctttcctggtaatcatcgttatt
ttaggtggtgtcatagtcagtgtttgccaagaaatatgggcgaaacaaaaattagatcaa
attgccttattagctagaccattagctacagttataagagaaactaaacaacaaaacata
gatcccagtgagatcgtcgtaggagatatattagtagtccattctggagatcaaatagta
gtagatggacaagtagtaggaaaagggcaaatagaagtagacgaatcactcctaacagga
gaatcagatctagttcctaaacaagcaggccagccagtttattctggtagtttctgtgtc
agtggcactgctcattatgaagcccaaaaagtaggaaccgaaagttttgcctatcaacta
acagttagtgccagagcatttcgccaaatttatacccctctccaacaggaaattaaccta
gtcatcagagtctttttactcttatcatgctttctctggatactagtttccattaactgg
tactttggattttataaatttgttgacactgttcaatatgctgctgtaattgctggctta
gtaccaagtggactttatttagccatcactcttgcttatgctttgggtgcagtcaaaatg
gtgggacaggaagtcctaattcagcaagctaatgctgttgaatcattaagtaatgtagat
attttatgtttggacaaaactggaacgttaaccactaaccatattagtttacaagcaatt
tatcccataggaattgatgaaatcaagttggaaaatatattaggtgaatatgcagccagt
accacttctaaaaataaaactattgaagctctagaaagggtctttccaagacctaaacgt
tctctaacctttgaaattccttttgcttcagctcgtaaatggagtggtatgagctttgcc
actgaagagcaaaattcaccatctgggacatacattctaggtgctccagaaatattagct
gaagttacacctcttagtaggaaatttactcagcaaattcaaaaattagcacaaaaggga
ttccgggtacttttatttgcctataaccccaacatcagtagcttagaccaggatttagaa
aaactacaattacctacagaactttttcccttgggaattattagctttcaagatgaactt
aggccggaagctcgtgagactatagaaggtttttcaaaagtaggaataaaaatcaaagtg
atttctggagataatcctcagactgtagctactttggccttgcaagcaggacttagttct
aatatccaagttatttctggttctgaattagctaaactagacgaagatcagtttattcaa
gcagcaaaatctaagacaatttttggctctgtcactcctaagcaaaaagctaaactgatc
catagttttaagaaacaaggtcattatgtagctatgatcggagatggggttaatgatgtt
ctatctttgaaagaagctaatttagcgatcgctatggaaggaggtagtaaggcgactcgt
agcgtggcagatattgtcctgttgaataattctttcgcctctttgccccatacttttttg
gaaggacaacgtattcgtaatagtatacaagatgtattgaaattatttatgattagggta
ttctgcgtaagtatattaattttttctacaggatttattggtggatttatcggtggtact
ttcccactattaaataaacatagtgcagttgtaactctaatatcagtaggatttcctact
ttttgtattccaatatgggctaaaccaggaatcttacctcgacgtagtatgatacgctcc
ttactacattttactttacctgctacttttagtcttactcttgtagccttactagtttat
ctaacctatttagcaataccattttcaggaaatgagttagttatcgaccttgaccaagtt
aatgagtttctttctgttcctcgtagtgccctagttacaattatgattttatgtggtcta
ttgttagtaccttttttgaagcctccaacaaaagcttgggtaggtggagaaacttacagt
ggtgactggcggtatacttttgttgccttagctttactaggagtttatatagtcatttta
gccgttccccctctacgtcaattttttgaactatctttactaagtactcatgattatctt
gtgattatttgggtagctttagtttggtgtttattactacgctatgtatggcgaaccaaa
cttctagataaatttttaggtgtcgatcttagttaa

DBGET integrated database retrieval system