KEGG   Tessaracoccus aquimaris: BW730_03985Help
Entry
BW730_03985       CDS       T04732                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
tes  Tessaracoccus aquimaris
Pathway
tes00860  Porphyrin and chlorophyll metabolism
tes01100  Metabolic pathways
tes01110  Biosynthesis of secondary metabolites
tes01120  Microbial metabolism in diverse environments
Module
tes_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tes00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BW730_03985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tes01007]
    BW730_03985
Enzymes [BR:tes01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BW730_03985
Amino acid related enzymes [BR:tes01007]
 Aminotransferase (transaminase)
  Class III
   BW730_03985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQP46813
UniProt: A0A1Q2CL23
Position
844183..845496
Genome map
AA seq 437 aa AA seqDB search
MAEVTHNGTENVTDDLFAHAREVIPGGVSSPVRGYGSVGGTPVFVASASGPYTTGVDGRE
YVDLVCSWGPALLGHAHPEVVEAVQDAASRGLSFGAPTAAEVELADVVRSRVPVAEQVRF
VSTGTEATMTAIRLARAATGRDAIVKFAGCYHGHSDALLAEAGSGVATQGLPGSAGVTKA
AAGDTIVVGYNDLDALERVFAEAGDRIAAVITEAAPANMGVVAPQPGFNAALRDLTARHG
ALLIVDEVLTGFRVSPGGWLGLDGGYAPDLVTFGKVIGGGMPLAALGGRADLMQLLAPVG
PVYQAGTLSGNPLATAAGLATLRLADDAVYATVDARSLELQAAVADALTAASVPHHISTA
GNLFSVFFREGPVANYADAKAQDQAAFARFFHAMLDSGVALPPSAFEAWFLSAAHDDVAM
GRIVEALPGAARAAAHS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgacccacaacgggacagagaacgtgacagacgacctgttcgcgcacgcc
agggaggtgatccccggtggggtgtcctcaccggtgcgcggctacggctcggtcggcgga
acccccgtgttcgtggcgtccgcgtccgggccctacaccaccggcgtcgacggccgtgag
tacgtcgacctggtctgctcgtggggccccgcgctgcttgggcacgcgcaccccgaggtg
gtcgaggcggtgcaggacgcggcgtcgcgggggctgtcgttcggcgccccgacggccgcc
gaggtcgaactggccgatgtggtgcgatccagggtgccggtcgccgagcaggttcggttc
gtgtcgaccggaaccgaggccaccatgacggcgatccggctggcgagggcggcgaccggg
cgcgatgccatcgtcaagttcgcgggctgctatcacggccacagcgacgccctgctcgcc
gaggcgggctccggagtcgcgacgcagggcctgcccggctccgctggcgtcaccaaggcc
gctgcgggcgacaccatcgtcgtcggctacaacgacctggacgcgctcgaacgggtcttc
gcggaggcgggggaccggatcgcggccgtcatcacggaggccgcgcctgccaacatgggc
gtcgtggcgccgcagcccggcttcaacgccgcgctgcgtgacctgacggcccgccacggg
gcgctcctgatcgtcgacgaggtgctgaccgggttccgcgtcagccccggcggctggctc
gggctcgacggcggctacgcgccggacctggtcaccttcggcaaggtcatcggcggcggg
atgccgctcgcggcgctcggcggccgcgccgacctgatgcaactgcttgcccccgtcgga
cccgtctaccaggcaggcaccctgtcgggaaacccgctcgccaccgcggctgggctcgcc
acgctgcgactggccgacgacgccgtctacgccaccgtcgacgcccgctcgctcgaactg
caggcagcggtcgccgacgcgctgaccgccgcctcggtgccgcaccacatctcgacggcg
ggcaacctgttctcggtgttcttccgcgaggggcccgtcgcgaactacgcagacgccaag
gcccaggaccaggcggcgttcgcccggttcttccacgccatgctcgattccggggtggcg
ctgccgccgtcggccttcgaggcatggttcctgtccgccgcgcacgacgacgtggctatg
ggtcggattgtcgaggctcttccgggggccgcgcgggcggccgcgcattcatga

DBGET integrated database retrieval system