KEGG   Tessaracoccus aquimaris: BW730_09100Help
Entry
BW730_09100       CDS       T04732                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
tes  Tessaracoccus aquimaris
Pathway
tes00860  Porphyrin and chlorophyll metabolism
tes00970  Aminoacyl-tRNA biosynthesis
tes01100  Metabolic pathways
tes01110  Biosynthesis of secondary metabolites
tes01120  Microbial metabolism in diverse environments
Module
tes_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tes00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BW730_09100
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BW730_09100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tes01007]
    BW730_09100
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tes03016]
    BW730_09100
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:tes02048]
    BW730_09100
Enzymes [BR:tes01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BW730_09100
Amino acid related enzymes [BR:tes01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BW730_09100
Transfer RNA biogenesis [BR:tes03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BW730_09100
 Prokaryotic type
   Other AARSs
    BW730_09100
Prokaryotic defense system [BR:tes02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BW730_09100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AQP47628
UniProt: A0A1Q2CND6
Position
complement(1923051..1924514)
Genome map
AA seq 487 aa AA seqDB search
MTTDAPARTRVAPSPTGDPHVGTAFMALFDLAWARKTGGQFVLRIEDTDQNRLVAGSEQQ
IYDSLDWLGLSPDESPAKGGPYAPYKQSQRLETYRPFVEQLVADGHAYYCWCSSERLAEL
REEQNRQKLSTTGYDRLCYGKTREERAALPGFSETPVVRMLIPDDAPLEFDDIIRGSVKA
PRPDDQVILKADGFPTYHLAVVVDDHLMGINTVVRGEEWISSTPKHILLYRWLGWELPAF
AHMPLLRNTDKSKISKRKNPAARLMWFKEQGYLPEAVRNFLQLLGYAGDEEHEVSTFEEF
VENFSWSKVNTVGPIFDLKKLDWLNGAYLRSLSADDLADQIAAFASDTGQWVDPNDEQLA
VLRQAVPIIQERLVLLKDALPQLDYLLESDANLVIEPTTVSELPDNAAEILDAAIEVTGS
VDFDAASIQADLREKIVDGMGIKPKFAFGPIRIAISGRKVSPPLFESMEILGRDSSLTRL
RSLRAQI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgacgcgcccgcccgcacccgagtcgccccgtcgcccaccggcgacccacac
gtcgggaccgccttcatggcgctgttcgacctggcctgggcacgcaagaccggcggccag
ttcgtgctccgcatcgaggacaccgaccagaaccggctggtggcgggctccgagcagcag
atctacgactcgctcgactggctcggcctctccccggacgagagcccggccaagggcggc
ccctacgcgccgtacaagcagtcgcagcgcctcgagacctaccggcccttcgtcgagcag
ttggtcgccgacggccacgcctactactgctggtgctcgtcggagcgcctcgccgaactg
cgcgaggagcagaacaggcagaaactgtcgaccaccggctacgaccggctctgctacggc
aagactcgcgaggagcgcgccgcgcttcccggcttctccgagacgcccgtggtgcggatg
ctgattccagacgacgccccgctcgagttcgacgacatcatccgcggcagcgtcaaggcg
ccccgccccgacgaccaggtgatcctcaaggccgacgggttcccgacctaccacctcgcg
gtcgtcgtcgacgaccacctgatgggcatcaacacggtggtccgcggcgaggagtggatc
tcctcgacgcccaagcacatcctgctgtaccgctggctgggctgggagcttcccgcgttc
gcgcacatgccgctgctgcgcaacaccgacaagtcgaagatctccaagcgcaagaacccg
gccgccaggctgatgtggttcaaggagcagggctacctgccggaggcggtgcgcaacttc
ctccagttgctcggctacgccggcgacgaggagcacgaggtctccaccttcgaggagttc
gtcgagaacttctcctggtcgaaggtcaacaccgtcggcccgatcttcgatctgaagaag
cttgactggctcaacggggcctacctgcgttccctgagcgccgacgacctcgccgaccag
atcgcggccttcgccagcgacaccgggcagtgggtcgaccccaacgacgagcagttggcg
gtgcttcgccaggccgttccgatcatccaggagcgcctggtgcttctcaaggacgcgctg
ccgcaactggactacctgctcgagtccgacgcgaacctggtcatcgagccgaccacggtc
agcgagcttcccgacaatgccgccgagatcctcgacgccgccatcgaggtcaccgggtcc
gtcgacttcgacgcggccagcatccaggcagacctgcgggagaagatcgtcgacggcatg
ggcatcaagccgaagttcgcgttcgggccgatccggatcgcgatctcagggcgaaaggtc
tccccgccgctgttcgaatcgatggagatcctcggccgcgactcgtccctgacccggttg
cgctcgctgcgcgcccagatctag

DBGET integrated database retrieval system