KEGG   Tessaracoccus aquimaris: BW730_11440Help
Entry
BW730_11440       CDS       T04732                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
tes  Tessaracoccus aquimaris
Pathway
tes00460  Cyanoamino acid metabolism
tes00500  Starch and sucrose metabolism
tes01100  Metabolic pathways
tes01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BW730_11440
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BW730_11440
Enzymes [BR:tes01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BW730_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like PA14
Motif
Other DBs
NCBI-ProteinID: AQP48007
UniProt: A0A1Q2CPF3
Position
complement(2435089..2437521)
Genome map
AA seq 810 aa AA seqDB search
MTATADRQTHIDALVAALDLETKVRLLTGEDFWTTKEVPEIGLRAMTLSDGPSGVRGPVW
DERSPSLNLPSATALASSWDVALAHEFGAAAASEARRKGVDWVLGPTINIHRSPLGGRHF
ECFSEDPALTGDLAFEYVRGLQDNGVAATPKHYVANDFETDRFTVDVVVDERTLREVYLA
PFERAVEAGAWSIMSSYNSVNGVTMTENDLLRDPLRTEWGWDGVVVSDWTAVRSTAAANA
EQDLEMPGPGVWGDALLRAVRAGDVEEAAIDRHVARLLLLADRVGALGGSHVQPVAALDG
VEFVRRAAAEGSVLLSNAGLLPLDPQGLSRVAVIGHNADEARTQGGGSATVVPEHVVNPL
DGLRQVLPGVDVVYSLGAIVQEGVGPLDPRRLTNPTTGGAGLTATFVAPDGTRIHSEDRF
ATSLTWFGGGEEYIASAAMLVLETIFTPAATEVRELGFATSMRGRVFVDDELLFEDQPKA
TGADLGAALLAPPSETRPVSLTADVPVRLRVEFDLGSSQFQVAGAIGLTFGTAPLSLDPT
ALIQEAAANAAASEIAIVVVGTNSRVESEGYDRDDLDLPGHQDDLVRAVAAANPNTIVVV
NSGSPVLMPWRDEVAAILVGYFGGQEFGNAIADMLTGAVEPGGRLPTTWPASIEDVPVLD
CTPTDEGKVAYSEGIHVGYRAWLKAGRKPAFPFGFGLGYTTWKIADVQCQVEGDEAVLTA
TATNTGTRAGKHVVQVYASRPGSTVDRPARWLVGFAVARAGAGEASEVSIRVPRRRFEHY
ADGWQVEPGGFALHVGGSVASTEADAEVTW
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgccgatcggcagacccacatcgacgccctcgtcgccgcgctggatctc
gagaccaaggtgcggttgctcaccggtgaggacttctggacgaccaaggaggtccccgag
atcggcctgcgcgcgatgacgctctccgacggcccctcaggagtccgcggccccgtctgg
gacgagcgctcgccgtcgctgaacctgccgtcggccacggccctcgcctcctcgtgggac
gtcgcgctcgcgcatgagttcggcgcggcggctgcgtccgaggcccgacgcaagggggtc
gactgggtgctcggcccgacgatcaacatccatcgctcgccgctgggcgggcgccacttc
gaatgcttcagcgaggaccccgccctgacgggcgacctcgcgttcgagtatgtgaggggg
ctgcaggacaacggagtagccgccacccccaagcactacgtcgccaacgacttcgagacc
gaccggttcaccgtcgacgtcgtcgtcgacgagcgcacgctgcgggaggtgtacctcgcg
ccgttcgagcgggccgtcgaggcgggcgcctggtcgatcatgagctcctacaacagcgtc
aacggcgtcaccatgaccgagaacgacctgctgcgtgacccgttgcgcaccgaatggggc
tgggacggcgtggtcgtctcggactggaccgccgtccgctcgaccgcggcggcgaacgcc
gagcaggacctcgagatgcccggccctggcgtctggggcgacgcgctcctcagggcggtg
cgggcaggtgacgtcgaggaagcggcgatcgaccgccacgtcgcccggctgttgctgctg
gccgaccgcgtcggggccctcggaggctcgcacgtgcagccggttgccgcgctggacggc
gttgagtttgtgcggcgcgccgcggccgagggcagcgtgctgctctccaacgctggcctc
ctcccgctcgacccgcaagggctctcacgggtcgctgtgatcggccacaacgccgacgag
gcgcgcacccagggtggcggcagcgccacggtcgtgcccgagcacgtggtcaacccgctc
gacggtctgcgccaggtactgcccggcgtcgacgtggtctactccctcggcgcgatcgtc
caggagggcgtcggcccgctcgacccgcgacgactgaccaatcccaccaccggtggcgcg
gggctgaccgcgacgttcgtggcgcccgacggcacgcggatccacagcgaggaccgcttc
gccacctcgctcacctggttcggcggcggagaggagtacatcgccagcgcggccatgctc
gtgctggagacgatcttcacgcccgccgcgaccgaggttcgggagctggggttcgccacc
tccatgcggggccgggtcttcgtcgacgacgaactcctcttcgaggatcagccgaaggcg
accggggccgacctcggcgccgcgctgcttgcgcccccgtctgagacccgaccggtgtcg
cttaccgcagacgtccccgtccgactgcgcgtcgagttcgacctgggctcctcgcagttc
caggtcgcgggtgccatcggcctcaccttcggcaccgcgcccctctcactcgatccgacg
gcgctgattcaggaggcggccgcgaacgcggcggcctcggagatcgccattgtggtggtg
gggaccaactcgcgggtcgagtccgagggctatgaccgcgacgacctcgacctgcccggc
catcaggacgacctcgtcagggccgtggcggccgcgaaccccaacacgatcgtggtggtg
aactcgggatcgccagtgctgatgccctggcgcgacgaggtagcggccatcctggttggc
tacttcggagggcaggagttcggcaacgccatcgccgacatgctcaccggcgccgtcgag
cccggcggcaggctccccaccacctggccggccagcatcgaggacgtcccggtgcttgac
tgcacgccgacggacgagggcaaggtggcctactccgaagggatccacgtcggctaccgc
gcgtggctgaaggcgggacgcaagcccgcgttcccgttcgggttcgggttgggctacacc
acgtggaagatcgcagacgtccagtgccaggtcgagggcgacgaggccgtgctgacggca
acggccaccaacaccggcacgcgcgcaggaaagcacgtcgtgcaggtctacgcgtcccgg
ccagggagcaccgtcgatcggccggcccgctggctcgtcggcttcgcggtcgcaagggct
ggcgcaggggaggcgagcgaggtgtcgatccgggtaccccggcgacgcttcgagcactac
gcggacggctggcaggtggagccgggcgggttcgcactgcacgtcggcggaagcgtcgca
agcaccgaggctgatgcggaggtgacctggtga

DBGET integrated database retrieval system