KEGG   Tetrahymena thermophila: TTHERM_000283749Help
Entry
TTHERM_000283749  CDS       T01020                                 

Definition
(RefSeq) GPI transamidase component Gpi16 subunit
  KO
K05292  GPI-anchor transamidase subunit T
Organism
tet  Tetrahymena thermophila
Pathway
tet00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    TTHERM_000283749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 GBP_C
Motif
Other DBs
NCBI-GeneID: 24438194
NCBI-ProteinID: XP_012653625
UniProt: W7XBT0
AA seq 517 aa AA seqDB search
MIGNKQIYLLAILIIFQVAVCELQSKESLKFYPLQDSDKSLAVFKSSYSHDIDLNSLFRD
EYIFPSTLLDNLHLTNTKDFEIHAGCGSFNSVLFDKDAALLDEVEFPMNGVQTLIYGDNV
FYEAGIETLSELFKFSRFSIKSENKFEFQSSFASTKEFKNKFIFAQDPTDYICSDNIEKL
KKYLPCLGNKGVFDLIDQTTLFRSSYVGIVIKVKIEKNRVNLSLQVVSEFLNSQKDAIFV
SNKYVEACPYIQDSAIISGDQKIEASNKRIENTNETSENETSMAKLVYKRLSSIELPEKQ
KKNGKQLHKLNLIKSKRFMKNNWYYHEDALVHTIKNRSDKYTLDVETAEYLNYYFYPVFS
QVKVSIDGVNLLEKDPYNKSILSFERLSNNNVLFKIKVELKPNQEVSIVIPMIKMMKSFE
NYPYDPQRGHDIIAVPIIYRIKEQNSEYGQTPVIKISANTVAFLPEPDFSMPFNIITFVC
VLMGYIFLQIFRLSTEKVNSEGHDDNILKKILDLFRK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaataagcaaatatatctattagcaattttgatcatttttcaagtagcagtt
tgcgaactgcaatcaaaggaatctcttaaattctatcctcttcaagattcagataaatct
ttagcagtatttaaatcatcttacagccatgatatagatttaaattcattatttagagat
gaatacatttttccttcaactttgttagataatttgcatttaacaaacacaaaagatttt
gaaatacacgcaggttgtggttcatttaatagcgttctctttgataaagacgctgctttg
ttagatgaagtagaattccctatgaatggagtttagacattaatttatggcgataatgta
ttttatgaagctggtatagaaactttgagtgaattattcaaattctctcgcttcagtatt
aaaagcgaaaacaaatttgagttttaatctagctttgcatctactaaagaatttaaaaat
aaatttatctttgcataagacccaacagactacatttgttcagataatattgaaaaattg
aagaaatatctcccttgtttaggtaataagggtgttttcgatttaattgattaaacaaca
cttttcagatctagttatgtaggtattgtaatcaaagttaaaattgaaaaaaatagggta
aacttgagcttataagttgtttctgagtttttaaatagctaaaaagatgcaatatttgtt
tctaacaaatacgttgaagcttgtccctacatttaagactctgccatcatatcaggtgat
taaaaaattgaagctagcaacaagagaattgaaaatacaaatgaaacctctgaaaatgaa
acatcaatggcaaaactagtctacaagagattatcaagcatagaattacctgaaaagcaa
aagaaaaacggaaaatagcttcataaacttaatttaattaagtctaagagatttatgaag
aataattggtattatcatgaagatgcattagtccatactattaaaaatagaagtgataaa
tatactctagatgtcgaaacagcagaatatcttaactattatttttaccccgtattttct
taagtcaaagtatctatagacggcgttaaccttttagagaaagatccttacaacaaatca
attctttcttttgaaagattgagtaacaacaatgtcttgtttaaaataaaagttgaactt
aaaccaaaccaagaagttagtattgttattcctatgattaaaatgatgaaatcattcgaa
aattatccctatgatccttaaagaggtcacgatattatagctgtccctattatctacaga
atcaaagagcaaaattctgagtatggataaacccctgtcattaaaatttcagctaataca
gttgcattcttaccagaacctgatttttctatgccctttaacattattacttttgtctgt
gtacttatgggatacattttcctctaaattttcagactatccactgaaaaggttaattca
gaaggtcatgatgataacatccttaagaaaatacttgatttatttagaaagtga

DBGET integrated database retrieval system