KEGG   Tetrahymena thermophila: TTHERM_000590239Help
Entry
TTHERM_000590239  CDS       T01020                                 

Definition
(RefSeq) protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
tet  Tetrahymena thermophila
Brite
KEGG Orthology (KO) [BR:tet00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tet01001]
    TTHERM_000590239
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     TTHERM_000590239
Protein kinases [BR:tet01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   TTHERM_000590239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 24439741
NCBI-ProteinID: XP_012654026
UniProt: W7X2I6
AA seq 310 aa AA seqDB search
MDIQPRDAEQGVQKSSLQDIACKQQQSNGQLANSDSKEPGKKCGEINGEGGEQVEKLNSK
EEIKKNGSQTNNFSIVSLSEIQLEDRLFNITEIYNVELSPTSISIAYDAYLKRNVIIKKI
FKDKLDQLQTKQAILECQQTCALDHFNIVKGYDYYEKENEFILLMELVNDADYFQEKVEN
CHTPIKNELKLKSYVTDILNGLIYLHDQGFIHCDLKLANIFCEKHESDDDGVQIRRVKIG
DLGLIQKIDAEKKTAYLEETCGTFGFKAPEAKKGAHITQQVKQKLVTQIANLNLINISLI
CGVQALSYIL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggatatttagccaagagacgcggagtaaggtgtccaaaaatcttcattgcaagatata
gcatgcaaataataatagagtaatggataattggcaaattctgactcaaaggaaccagga
aagaaatgtggggaaataaatggagaaggcggagaacaagttgaaaaattaaatagcaaa
gaagaaattaaaaaaaatgggtcttaaactaataatttcagtattgtatccttatctgaa
atttagttagaagatagattatttaatatcacagaaatatataatgtggagttaagcccg
acaagtatatcaatagcatatgatgcatatttaaaaaggaacgtgattataaagaaaata
ttcaaagataaattagattagttgtaaacaaaacaagctatattagagtgctaataaacg
tgtgctttagatcattttaatattgttaaaggatatgattattatgaaaaagaaaatgag
tttatactcctcatggagttagtaaatgatgctgattacttttaagaaaaagttgaaaat
tgtcatacacctattaaaaatgaactcaagctgaaaagttacgttactgatatactaaac
ggattaatttacctgcatgattaaggttttatacattgtgatcttaaattagccaatatt
ttttgtgaaaagcatgaaagtgatgatgatggagtttaaataagaagagttaaaataggg
gatttgggtttgatttaaaagattgatgcagagaaaaaaacagcttatttggaggagact
tgtggaacattcgggtttaaagctcctgaagcaaaaaaaggcgctcatattacataataa
gtaaaataaaaattagtcacataaatagctaatttaaatttaataaatattagtctgata
tgtggagtttaggcattatcttatattttatga

DBGET integrated database retrieval system