KEGG   Tetrahymena thermophila: TTHERM_00083410Help
Entry
TTHERM_00083410   CDS       T01020                                 

Definition
(RefSeq) lysozyme protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 7839343
NCBI-ProteinID: XP_001012587
TGD: TTHERM_00083410
UniProt: Q237A8
AA seq 236 aa AA seqDB search
MNKLLIASLTILLITSFASAQKGILGFTPLYSGYSQDQYLCMRNSQNGFKYQNLVEKQIW
GYDRYHKIGQNYADNVGLSTNSIYVPCININTTDYPYFGQENQLLTFLKYFQQNHDVLKG
DFLWISIEQNQSKNCQWHNDFNVNCSVLDEIMTQVRRSAVGVDRFGIMASKQDWEALFGN
KCNKYSSFPLHYKNYDNKPNFSDWNEQKFGGWTKPSMKTYSKGKFECYIDADLTVY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactattaattgcaagtttaactatccttttaattacttcttttgcaagtgct
taaaaaggaatcttgggatttactccattatactcaggatattcctaagattagtattta
tgcatgagaaactcttaaaacggattcaaatactaaaacctagttgaaaaatagatctgg
ggttatgatcgttaccacaaaatagggtaaaattatgctgataatgttggtttgtccact
aattctatttatgttccctgcatcaatatcaacacaactgactacccctattttggttaa
gaaaactaactcctcacattccttaaatacttccaacaaaaccacgatgttttaaaagga
gattttttgtggatttctatagagtaaaattaatctaaaaattgctagtggcataatgac
tttaatgttaattgttcagttcttgatgaaataatgacttaagttagacgctcagctgtt
ggagttgatagatttggtataatggcaagcaagtaagattgggaagccctttttggaaat
aaatgcaacaagtacagtagtttccctctccactataaaaactatgacaataaacctaat
ttcagtgattggaatgaataaaagtttggtggctggactaaaccttcaatgaaaacttac
tccaagggaaaattcgaatgctacatagatgctgatttgactgtgtattga

DBGET integrated database retrieval system