KEGG   Tetrahymena thermophila: TTHERM_00129820Help
Entry
TTHERM_00129820   CDS       T01020                                 

Definition
(RefSeq) glycosyl hydrolase family 20 beta-N-acetylhexosaminidase family protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tet  Tetrahymena thermophila
Pathway
tet00511  Other glycan degradation
tet00520  Amino sugar and nucleotide sugar metabolism
tet00531  Glycosaminoglycan degradation
tet00603  Glycosphingolipid biosynthesis - globo and isoglobo series
tet00604  Glycosphingolipid biosynthesis - ganglio series
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTHERM_00129820
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    TTHERM_00129820
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    TTHERM_00129820
   00604 Glycosphingolipid biosynthesis - ganglio series
    TTHERM_00129820
   00511 Other glycan degradation
    TTHERM_00129820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tet03110]
    TTHERM_00129820
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TTHERM_00129820
Chaperones and folding catalysts [BR:tet03110]
 Intramolecular chaperones
  Others
   TTHERM_00129820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b Rep_2
Motif
Other DBs
NCBI-GeneID: 7833869
NCBI-ProteinID: XP_001016450
TGD: TTHERM_00129820
UniProt: I7M7X8
AA seq 551 aa AA seqDB search
MQKILLITFLLGIALAQITPGVDPISAKVMPKPKNYTYGDLSLLVTDPCGISYRPSVGSG
KVPNHVYQIIGFYTLNIFNSNENSCAIQRELYKNETTIEKMRRLQHSQNIVFDIFIQDAT
LATADTLEDEYYDLQIYNTTYWKLTANKYVGLLRGLETYSQLFTQDEDTEDWYLNNIPIS
IQDQPDYIYRGLMIDSARHFLSVETILKTIDSMLFNKLNVLHWHITDTESFPFPLKSFPN
ITKYGAYSKKKQYSFEDIQYIVDQALNKGIQVIPEVDSPGHSFSWARSPQFSTIALLCDK
YNGQLDPTLNLTYTAAKGIMEDMNKQFYTAKFVHFGGDEVNEKCWDQRPEIKEFMKQNNI
STYTDLQNYYRKNQVNIWKSINATKPAIFWANSNTLKYGPDDVIHWWGSTHDFSSIKDLP
NKIILSFHDNTYLDIGEGNRYGGSFGSMFNWDVLNSFNPRVPGIKGEVLGGETCLWSEMN
DDYTQFQRIWTRNSAFAERLWNTDAANNETYKTRALVSRMVFMQHRLTARGIPASPVTVG
ICEQDLSLCYN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtaaaagatacttttaataactttccttcttggaatagctcttgctcaaattactcct
ggcgttgaccctatttcagctaaggttatgcctaaacctaagaattacacttatggagat
ttgagcttacttgtcactgatccttgcggaatctcttacagaccttctgttgggtcagga
aaagtacccaaccatgtctatcaaattattggattctacactttgaatattttcaattct
aacgaaaactcttgtgccattcaaagagaattgtataagaatgaaacaaccattgaaaag
atgcgtagattacaacattcctaaaatattgtcttcgatatttttatctaagacgctact
ttggccactgctgacacactcgaagacgaatattatgatttataaatttataataccaca
tattggaaattgactgctaacaaatatgttggtttactccgtggtttagaaacttactct
caattattcacttaagacgaagacactgaagattggtatttgaataacatccccatttct
attcaagattaacctgactacatctacagaggtcttatgattgattctgccagacatttc
ttatcagttgaaactattttaaaaactattgattctatgttattcaacaagttgaatgtt
ctccattggcacatcactgatactgaatcctttccctttcctcttaaatcattccctaat
atcactaaatacggagcctactctaagaagaaacaatacagcttcgaagacattcaatac
atcgtagactaagctctcaacaagggtatttaagttattcctgaagtcgattctccagga
cactctttttcatgggcaagatctccttaattctccactatagctttattatgtgataaa
tataatggacagttagacccaacacttaacttaacttacactgctgctaaaggtattatg
gaagatatgaacaaatagttctacactgctaagtttgttcattttggtggtgatgaagtt
aatgagaaatgctgggattagcgccctgaaattaaggaattcatgaagtaaaataatatc
tctacatatactgatttgtagaattattacagaaagaactaagttaatatttggaaatca
attaatgctactaagcctgctattttctgggctaattcaaatactttgaaatatggtcct
gatgatgttattcattggtggggatccactcatgatttctcttcaatcaaagatcttcct
aacaaaataattttatcttttcatgataatacctacttagatattggagagggaaacaga
tatggtggtagttttggtagcatgttcaactgggatgtcttaaactctttcaatcctaga
gtacctggaattaagggtgaagttcttggaggggaaacatgcttatggagtgaaatgaat
gatgattatacttaattttaaagaatatggacaaggaatagtgcatttgctgaaagactt
tggaacactgacgctgctaataatgaaacttacaaaactagagctttagttagcagaatg
gtctttatgcaacaccgtttaactgctagaggaatacctgcttctcctgtaacagttggt
atttgtgaataagatctttctctatgctataactga

DBGET integrated database retrieval system