KEGG   Tetrahymena thermophila: TTHERM_00194370Help
Entry
TTHERM_00194370   CDS       T01020                                 

Definition
(RefSeq) cation channel family protein
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
tet  Tetrahymena thermophila
Pathway
tet04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tet00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    TTHERM_00194370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tet01009]
    TTHERM_00194370
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tet04040]
    TTHERM_00194370
Protein phosphatases and associated proteins [BR:tet01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TTHERM_00194370
Ion channels [BR:tet04040]
 Ligand-gated channels
  IP3 receptor
   TTHERM_00194370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RIH_assoc RYDR_ITPR Ion_trans Ins145_P3_rec Tmemb_9 HBS1_N
Motif
Other DBs
NCBI-GeneID: 7823162
NCBI-ProteinID: XP_001017190
TGD: TTHERM_00194370
UniProt: Q23K98
AA seq 2827 aa AA seqDB search
MSQVKFGDYITIQGTLLDKNNTNGAHYGYMCTTGFTNNEIYLEKQSKSIFANTSNQDQQI
SQKPEDNVFSIKNYREYVFQIWPKLDYDAHKKYSKLLEEKNQIQKKLKSSKDNIDISEED
QERMKEYLNEVREKIKIAKIAKESEKANNLKQLESVKGNFVCYGQEIFLMHADSQSFLNG
LLQASVSEKSAFMLQVTKFFQRGMVFKFQPKYKLRKEGEIIQYKDQISIFNVKQQCWANF
VPSNITQQDKIIQGPTPTNYYQSIDFQKYQNRQRVEVFLTKVKEAFWQIHIHSDYIQNQE
TSIKGGDLIYLYHTELQGALTADISYDNKKGYSEAYIRKYQGEYELEKYSVASIWEIEKD
SCFDRGSNIPVSSLSNQDKKSTQSFKIRHFLTGKVLSIQQVNQGQYIPCLAKDDLTTLEN
SSKIQFVSTQNDENEIMEDNHCYLIKINDQFIQANSSIQYTVQKHEKNSENKLNVTDFKD
VTENMIYKPIDDSEFEVYRNGLTCVDKGSTEENAFQVIKLTEEEKQNILYVNSSLNILHK
FLQKLRNVPYREPLPKKEYIKKVGQILSDLVLFVVKTESKNPLECEGIPIPKRQKIMKDY
KFIELLVDLLYYPFKTEVYKMKELDQIDPDTVKIFKLCNVLINNSIKEYRPNEIYASQWI
NLLIFQSEMTEGYCDIGSEETLTELIDNNKKILETIDEVTVNKFLQMLMENQNKKYVKLI
RALILCNGQPVHNQELISNYLLSGMDAISNDEDETGQVSQNKVSQVLQRQVDINKPLIIQ
AVKYINGEVWVQSPFKENYGKFMLLSKFQEMSTESQENLDKFEYFSEMIGMLSDLCKSRN
YTAINQLVHVYKRRVCFEIVQNSLFDPYLRRSFVMLIHTMYLDISDFKKFSLPNNIRVWT
EIEKAKSIVSVYDQQQNLEKVMGLNSFVSPLLYASNHLKVFSIEYIIGIAKSKYMSSLKE
PENLLTYSILQMIQDLVDFGFFDNSDELESLVKNIIKILDSSLDVGNQNEEEAAEEVVKL
LSCRTTISKGNIPQALKKLNHIQISRFTGRYEHTEDNLIVHECKTICCEILKKVILIRND
MRITQFMKKFKNEFDLITTFKPMNKNSKKKPSMKPLEIENPIQQFQRKRNPSDTPNSVNQ
SHIQGDKSPLINEVFSNQLKIEEGIQDVSEQERRQISQALAKRSQEMLDEIFFQNTIKLR
GCLKVDVVAIFQDLTLYQNSDLVNNSFEILNMLFTERQEILNLLQNLQLLEDHEQIQSYF
SMKQIQDNLSEQVEKSENWLFKYEEANIKEAVKVEINLQQIVQIQAQKLQGLPLPVIGIE
QGEDTGRLLNQKQDYNQGIRQEAINFIEQLFEEDEVKNQYSQELIRNSYLYQQIIDLLNY
DANTFTRKRQEEGINKLNFNDTSVFIRILRLCYKILGRLVIGNKQNQILLTDQVTDFIFK
HMKYLPQSYPHLLLDPLIEQNSLLIMHEEICRKFVKEIFNCINILKSHNILNLVSCYLDI
LKKIPYVNDIIVKENQTIIMDLLTSKENQNLLSFINFDDPSYKQLIHSSQQFQNFVDSGQ
EEIIDVPQELDYFDSLLSLMAAVCDSKNNATESKAQSYISLYQLKELLIKFKNCFYVKRS
LYFFFFHVYLDTEKEMSDQLLEIKKFIIQSIEDDLILITNNLDVQDIQLLNYKGKISLQK
IKLEYIFESLFLCVDTILCKKLLDTSSEKQFLTQLLESIIKVSQLSVLKQTHKRKLKGIL
IQLVVRGFTSIQKLKQHNINSQIIPNLLEVRQTQKNLQDYFSTTIQISHESTVQLSQKQA
TLLDVIKKLKKSEILQEEIRKEFKNFVDYFTDIKYISLKAFQGLCTIEFSELTTAMIKLM
VQNRFVNDYDNTQNELEKKRLQVLRQIIELENPESNDSIDLWDSLEGFEEEIIKRQNQLI
QQGVAEMIVEIIKDPQASSDIKEEAILLGIALLIGGNAKTQDEFLKALSSDSNNQFLGVL
YDMITRGLLLIKKNMSKLNKQVEFKLIEEQKQALDQQINLNDEDFDDKLSDDEAADVMDS
QDDDEESQIPQNVIQEIRRIRRVYRLLQLFCEGHNNQFQNHLRQQIIDQQESGKSIDFIM
NTTILFSSAVKYLNIHCIDLIDQILDFLIESIQGPCVENQITMCRGKINETCKDLLQKFQ
GNQEQNKQYYILGFDTEENKEELESLISKSFKLLYSLIEGDPSKDILQQMCQTLDFNHLF
QILDDKFKKILQQLNISFVQTLNFSDEKIRKIVDRLDSHFDESLEGVFDIYLLISTLSDK
DENVKQLLENPPDEYVSALKFFKYNTASIEVVFKNNLIRVYFPIQPICRLLSKNSRATLM
EEIPRSTTSEKIEGLVEATIDLFDEMEHLAFLKKQIFNFSSNRLQALMLISYTFALAINL
TILFTYKLTFEEFQKAKNYINPGALTTTVVFGIIQFITVLIIILFYIIIHGPLIIKRSWH
AIQEENEKFKKPQEEERIIEAKYLSLRDAVSVLMTKGPNAEEFWKSGKRDFGHFFVAFFY
YWRNFQTMMRQGSFIYLLFYVIVSAMGLFVSDITYCLLLLDIIARFPTLQNVVKAVTTNI
RQIGLTTLLGAVLIYIYSIFAFYFSDQTYKTTEVYGLDGEKGDQNTCTTLFQCYLYTLNQ
GLLHAAGIGEAIAKPSYEDPSTFIFRYFFDLSFFMIINIMFLNFIFGIIIDTFAQLRDEK
QKKEEDKNNVCFICGLSRNEFDKVPGGFTIHIEKQHQLWYYVYYIYHLKCKDSTEYNGVE
SYIQDLLNKQQTTWFPLLKALSLSKSEDQNQESQIENKFEKLKSGLKDVTSKVEKISSKK
IEKKKNK
NT seq 8484 nt NT seq  +upstreamnt  +downstreamnt
atgagctaagttaaatttggagactatattacaatttagggcaccctcttggataaaaat
aatactaatggagctcactatggctatatgtgtacaacggggtttacaaataacgaaatc
tacttagaaaaataatcaaaatccatatttgccaataccagtaattaagatcagcaaatc
agccaaaagccagaagataatgtcttctcaatcaagaattatagagaatatgttttttaa
atatggcccaagctcgattacgatgcccataaaaagtatagcaagcttttggaagaaaaa
aaccaaatataaaaaaagttaaagagcagcaaggataatatagacattagcgaagaagac
taagaaagaatgaaggagtatttgaatgaagtaagagaaaagattaagattgcgaaaatt
gcaaaagaatctgaaaaggcaaataatctgaaataattggaatcagttaaaggaaatttt
gtttgctatggttaggaaatatttttaatgcatgcagattcatagtcttttttaaatggt
cttttgcaggcttcagtcagtgaaaaatcagcttttatgctgcaagttactaaatttttt
tagagagggatggtttttaaatttcaacctaaatataagctacgtaaggaaggagaaatt
atataatataaagattaaatatcaatttttaatgtgaaataataatgttgggctaacttt
gtgccatcaaatataacttagtaagataagatcatctaaggtcctactcctacaaactac
tactaaagtatagacttttaaaaatactaaaatcgttaaagagtagaagtatttttgaca
aaagtaaaagaagccttttggcaaattcatattcatagtgactatattcaaaatcaggag
accagtattaaaggaggagatttaatttatttatatcatactgaattgcaaggtgcactc
actgcagatatttcttatgataataaaaaaggatattcagaagcatatattagaaagtat
tagggagaatatgaattagaaaagtattcagtagcttctatttgggaaattgaaaaagac
tcctgctttgatagaggtagcaatatacctgtgagcagtcttagtaaccaagataagaag
agtacctaatcttttaaaattagacattttttaactggtaaggttttaagcatacagcaa
gtaaatcaaggataatacattccctgcttggctaaagatgacttaactacgctagaaaat
tctagtaaaatctagtttgtatctacttaaaatgatgaaaatgaaataatggaggataat
cactgctatcttataaaaatcaatgattaatttatttaggccaattcatccatccaatat
actgtttaaaagcatgaaaaaaattctgagaacaagttaaatgttactgattttaaagat
gtaactgaaaatatgatttacaagcctattgatgatagtgaatttgaagtttatagaaat
gggctaacttgtgttgataagggaagcactgaagaaaatgcattttaagtaataaagtta
acagaagaagagaagcaaaatattttatatgtaaactcctcattgaatatactccataag
tttttatagaagttaagaaacgttccttacagagaacccttacctaaaaaagaatatatt
aaaaaagttggataaatactttctgatttagttttatttgttgtcaaaacagagagcaaa
aatcctttggaatgtgaaggtatacccattccaaaacgccaaaaaataatgaaagattat
aaattcattgaattactagttgatttgctttattatccattcaaaacagaggtttataaa
atgaaagagcttgattagatagatcctgatacagtcaaaatctttaagttatgcaatgtt
ttgattaataattctataaaggaatatagacctaatgaaatttatgcttcttaatggatc
aatttactcattttctaatctgaaatgacagaaggctattgtgatattggatcagaggaa
actctaactgagctaattgataacaataaaaaaattttagaaaccatcgatgaggtgact
gtgaataaattcttgtaaatgttaatggagaactaaaacaagaaatatgttaaactcata
agggcactaatactctgcaatggtcaacctgttcataattaagagttaatttcaaattat
ttgcttagtgggatggacgctatatctaacgatgaagatgaaacaggacaagtaagttaa
aataaagttagctaagttctatagcgttaagtggatataaacaaacctttgatcatttaa
gcagtgaagtatattaatggagaagtttgggtttagagcccttttaaagaaaactatgga
aaatttatgctgctttcaaaattttaagaaatgtctacagagtctcaagaaaatttagat
aaatttgaatatttttcagagatgataggaatgttaagtgacctatgtaaatctagaaat
tatacagctatcaattagttggtccatgtttataaaagaagagtgtgcttcgaaatagtt
taaaatagtctctttgatccctacttaagaagaagcttcgtcatgcttatacacacaatg
tatttggatatttcagatttcaaaaagttttcattacctaacaatataagagtttggact
gaaattgaaaaagctaaatcaatagtaagtgtctatgatcaataacaaaacttagaaaag
gttatggggttaaatagttttgtatcaccattactttatgcttcaaaccatttgaaagta
ttctctatagagtatattattggtatcgcaaaatcaaaatacatgagctcattgaaggaa
ccagaaaatcttttgacttacagcattctttaaatgatttaagatctagttgattttggt
ttcttcgataacagtgacgaactcgagagtttggtgaagaatattattaaaattttggat
tcttcattagatgttggaaattaaaatgaagaagaagctgcagaagaagtagtgaaatta
ttatcttgccgcactacaattagtaaaggaaatattccttaagccttaaaaaagttaaat
catatttaaatttcaaggtttacagggagatacgagcacactgaagataatctaattgtg
cacgaatgcaaaacaatctgttgtgaaatcttaaaaaaagtaattctaatcagaaatgat
atgagaatcacttaatttatgaagaagtttaagaatgaatttgacttgattactactttt
aagccaatgaataaaaattctaaaaaaaaaccgtctatgaaacctttagaaatagaaaat
cctatataacaattttaaagaaaaaggaatccatctgatactcctaattctgtaaactaa
agccatatacaaggagataaaagtccattgattaatgaagtattttctaattaattgaaa
attgaagaaggaatataggatgtttctgaataagaaaggaggtaaataagttaagcacta
gctaaaagatcttaggagatgttagatgaaatattctttcagaacacaattaaattaaga
ggatgcttaaaagtagatgtagttgctatattttaagatttaactctttattaaaattca
gatttagttaataattcttttgagattcttaacatgctattcacagaaagataagaaatt
ttgaatttgctgtaaaatctataactactagaagaccacgaataaattcagagctacttc
agcatgaagtaaatttaagataatttgtctgaataagttgaaaaaagcgaaaattggctt
ttcaaatatgaagaagcaaacataaaagaagctgtgaaggtagagatcaatctttagtag
attgttcaaatttaagcctagaagttgcagggtttacccttacctgtgattggaatagag
tagggcgaagatacaggtcgtttattgaattaaaaataagattacaattaaggaataaga
taagaagcaattaattttatagaatagctatttgaagaagatgaggtaaaaaattagtac
tcataggaactgattagaaacagctacttatatcaatagataatagatttgcttaactat
gatgcgaataccttcactcgtaagcgttaagaagagggaataaataagcttaattttaat
gatacctctgtttttattcgtattttacgcttatgctataaaattttgggaagattggtt
attggaaacaaataaaatcaaattttgcttactgattaagtaactgattttatttttaag
cacatgaagtatttaccataatcatatccccatcttcttttagatcccttaatagaacag
aattctctccttattatgcacgaagaaatttgtcgtaagttcgtaaaggaaatctttaat
tgcatcaatattttgaaatcacataacatattgaatttagtttcttgctatctagatata
ttgaagaaaattccttatgttaacgatataattgtaaaagaaaactaaacaattattatg
gatcttctaactagtaaagagaattagaatcttctctcttttattaattttgatgatcct
tcatacaaataacttatacattctagttaataattttaaaactttgtcgattcaggctaa
gaagaaattattgatgtaccataagaattagattactttgatagcttgctcagtttaatg
gctgctgtatgtgattcaaaaaataatgccactgaaagtaaagcacaaagttacatttcc
ctatactaattaaaggaactcctcattaaattcaaaaattgcttctacgttaagagaagt
ttatatttcttctttttccacgtatatcttgacactgaaaaagaaatgtctgattaactt
ctcgaaattaaaaagtttatcatctaatctattgaagatgatctaattttaattaccaat
aacttggatgtccaagatatttaattattaaactataaaggaaaaatatctctttagaaa
ataaaattggaatatatatttgaatctctattcctatgtgtcgacactattttatgtaaa
aagctacttgatacaagctcagaaaaataatttttaactcaattgcttgagtcaattatt
aaagtttcttagctttctgtgctcaagcaaactcataaaagaaaattaaaaggaatcctc
atttagttagttgtaagaggatttacatcaatttagaaactcaaatagcataatatcaat
agctaaataattccaaatctactagaggttcgttaaacataaaaaaatttacaagattat
ttttctactacgatctaaatatctcatgaaagcactgtttaactttcataaaagcaagcc
actttattagatgttattaagaaattgaaaaaatcagaaattttacaagaagaaataaga
aaagaattcaagaattttgttgattatttcacagatatcaaatacattagtttaaaggcg
ttccagggattatgtaccatagagttttcagaactaactacagctatgattaagttaatg
gttcaaaatagattcgttaatgactacgacaacacataaaatgaattagagaaaaagaga
cttcaagttcttaggtaaattatagagcttgaaaacccagaaagtaatgattctattgat
ttatgggactcacttgaaggctttgaagaagaaattataaaaagataaaattaactaatt
caataaggagtggctgaaatgatagttgaaattattaaagatccccaggcttcaagtgat
ataaaagaagaagctatattactaggtatagctttattgattggtggaaatgctaaaact
caggatgaatttcttaaagctttgtctagcgattcaaataattaatttttaggagttctc
tacgatatgattactagaggtttgcttctaattaaaaaaaatatgtcaaagctcaataaa
taagttgaatttaagcttattgaagaataaaagcaagctcttgattaacaaattaattta
aatgatgaagattttgatgataaattatctgacgacgaggcagcagatgtgatggatagc
taagatgatgacgaagaatcataaattccttagaatgtaattcaagaaataaggagaatc
agaagagtttatagattactctagcttttctgtgaaggccacaataatcaattctagaat
cacttgagatagtagatcatcgattaacaagaatcaggaaaatccatcgattttattatg
aacacaactatcttattttcaagtgcagttaaatatttgaatattcactgcatagatctt
attgattagatattggatttcttaatagaatccatataagggccttgtgtagaaaattaa
ataacaatgtgcagaggtaaaataaatgaaacttgcaaagacctcctttaaaaattccaa
ggtaatcaagaataaaataaataatattacattctcggttttgacacagaagaaaataag
gaagagttagagagtttgataagcaagtcatttaaattactttactctttgattgaaggt
gatccctccaaagacatacttcaataaatgtgctaaactttggatttcaatcacttattc
caaatcttagatgataaatttaagaagattttgtagcaattgaatatttcatttgtctaa
acattaaatttttcagatgaaaaaatcagaaagatcgtagatagattggatagccatttt
gatgagagtctagaaggagtgtttgacatttacctattaatttcaacactttcagataaa
gacgagaatgtaaagcaattgcttgaaaatcctccagatgaatacgtatcagccttgaag
ttctttaaatataacacagcttcaatagaagttgtttttaagaataatttgattagagtt
tatttcccaattcagcctatctgtaggcttttgagcaaaaatagtcgtgcaactttaatg
gaagaaattcctcgtagcacaactagtgaaaaaatagaaggtttagttgaggcaacaatt
gacttatttgatgaaatggaacatcttgctttcttgaagaaatagatttttaacttttca
agtaacaggttacaagcacttatgcttatatcttacacttttgctcttgctattaattta
acaatattatttacatataaactaactttcgaagagttttagaaagctaagaactacatt
aatcctggagctttaacaactactgtagtttttggaataattcaatttataactgtacta
atcatcattcttttctatatcattattcatggtccattaattattaaacgctcttggcat
gcaatataagaagaaaacgaaaaatttaagaaaccttaagaggaagaaagaattattgaa
gctaaatacctaagtctaagagatgctgttagtgtcttaatgacaaaaggtccaaatgca
gaggagttttggaaaagtggtaaaagagattttggccacttttttgttgcatttttttat
tactggagaaacttctaaactatgatgcgctaaggaagttttatatatttattattctat
gttattgtttctgctatgggtttatttgtatctgacataacctattgtttattattgtta
gatattatagctagattccctactcttcaaaatgttgttaaggcagttacaactaatatt
agacaaataggtttaacaactctattgggagctgtgcttatttatatttattctattttt
gctttttacttctctgatcaaacctacaaaactacagaagtctatggattagatggtgaa
aagggtgattaaaatacttgcacgacgctcttctagtgctatttgtatacattaaactag
ggtcttcttcatgcagcaggtattggtgaagctattgctaagcctagttacgaagatcca
agcacatttatatttagatatttctttgacttaagtttcttcatgattattaatattatg
ttcttaaacttcatctttggtatcatcatagacacttttgcataattaagagatgaaaag
caaaaaaaggaggaagacaaaaataacgtttgctttatatgtggcttatcaagaaacgaa
tttgacaaagtacctggaggatttactatacatattgagaagtagcattaactctggtat
tatgtatactatatttatcacctaaaatgtaaagatagcactgaatataatggtgttgag
tcttacatataagacttacttaataagtaataaacaacatggttcccattactaaaggct
ttatcactaagtaaatcagaggattaaaattaggaatcataaattgaaaataaatttgag
aaactaaaatcaggattaaaggatgtcacatctaaagtagaaaagatttcctctaaaaaa
atcgaaaagaaaaaaaataaatga

DBGET integrated database retrieval system