KEGG   Tetrahymena thermophila: TTHERM_00293460Help
Entry
TTHERM_00293460   CDS       T01020                                 

Definition
(RefSeq) myotubularin-related protein
  KO
K01108  myotubularin [EC:3.1.3.64 3.1.3.95]
Organism
tet  Tetrahymena thermophila
Pathway
tet00562  Inositol phosphate metabolism
tet01100  Metabolic pathways
tet04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TTHERM_00293460
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    TTHERM_00293460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tet01009]
    TTHERM_00293460
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     TTHERM_00293460
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     TTHERM_00293460
Protein phosphatases and associated proteins [BR:tet01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    TTHERM_00293460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 7833326
NCBI-ProteinID: XP_001013077
TGD: TTHERM_00293460
UniProt: I7M0W4
AA seq 801 aa AA seqDB search
MDFNQMSNMNSSQQLNDRQRTAQFGLQDLLQEEQYQQSPVTHTKSLADDYLTRPRSQNQN
QINANNSNNLIASSKNSNQNTNQSINDSASQSSGSNNIVSALIPNIVYDIIHHYWQKEPI
QQNEQQQKQVIKKIQKDEAPKFKPSHQNDYRQQLIDLGVKDKYILNGEQYIKDIQAGLKS
ATFRLEGKLILTNFKLIYVVTNGKYESLGSPDFYQIQLMMIQSCERTVEKKGNQFSYIDI
ECKDVRKYQFRFNFDQNEESQEFMGLLIDNAFNKEIYKYPAFVYKKYNDEEQQFNGWNIY
NIKKEFERMRINIYDPTQQNSNSNQEQFYYKYLNNELKDICDTYPPYLVVPYFMQEETIK
KCSKFRSRERLPVLTFGFKSSNEQKLPVTLWRCSQCRTGFSSRSTEDEQMLRLIGDPTNK
DNRSSNNVNVHIYDARPFMNAVGNKLAGKGYESNSCYKNCDIQFLDIHNIHKVRDSYNKL
VSVCLSSDQQIKWFKEVDSSQWLEHISSIIQGAVRICQSMLANNHVVVHCSDGWDRTSQL
CSLAQIFLDPYYRTIEGFCSLIQKDWVYFGHQFNLRQGHGQRNQSEETSPIFLQFLDCVH
QVQNYYPLSFEFNEQFLVDLAFSSYNCQYGTFLANSYQELVKQDIIKQTISVWSFLLSKR
HIYENPFYKKDDQIQTLKPDFQQRSLKIWNRYFFFYQFQRLDEYKIEQQKCRFNEDNIQN
QHKKSQEALQFYESLLKELKIQIPKQRVTPKDLANLVKQSIIKDYEAQQVFKQDSEYNEE
DYDIILKQSSHIVNQNSRQMN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggactttaattagatgagtaacatgaatagttcttagcaactaaatgataggtagagg
acagctcaatttgggttacaggatttgttataagaagaataatattaataatctcctgtc
acccatacaaaatctttagcagacgattatttgaccaggcctagaagctagaattaaaat
taaataaatgctaataatagcaataatttaattgctagctcaaaaaatagcaattaaaat
actaattagagtatcaacgacagcgccagctaaagtagtggatctaataacatagtatca
gctttaattccaaatatagtttatgatatcatacatcattattggtaaaaagaacctata
taatagaatgaataataatagaagtaggtaattaaaaaaatctagaaggatgaagctcct
aagtttaagccatcacactaaaatgattatagataatagcttatcgatcttggtgtaaaa
gataaatatattctaaatggagaatagtacattaaagatatccaagccggattaaaatca
gctacttttaggctagaaggaaaattaattttaactaatttcaaactaatttatgtagta
acaaatggtaaatatgagagtcttggtagtccagatttttactaaatctagttgatgatg
atttagagctgtgagagaacagtagagaaaaaagggaatcaattttcttacattgatatc
gaatgtaaagatgtaaggaaatattaatttagatttaatttcgattagaatgaggagtca
caggaatttatgggtttgctaatcgacaatgcctttaataaagagatatataaatatcct
gcttttgtttacaagaaatacaacgatgaggagcaataatttaatggttggaatatttat
aatataaaaaaagagttcgaaagaatgagaatcaacatttacgatccaacttaacaaaat
tctaactcaaattaagagcaattttactacaaatatctcaacaatgaacttaaggatata
tgtgacacatatcctccttacctagtagtcccatattttatgtaggaagaaacgattaaa
aagtgctcgaaattcagatcaagagagcgtcttccagttttaacatttggattcaaaagc
tcaaatgaataaaaattaccagtcactctttggaggtgctcacaatgtagaactggattt
agcagccgttctacagaagatgaatagatgctaagattgataggagaccctactaataaa
gataataggagttcaaacaatgtgaatgtccatatttatgatgccagaccttttatgaat
gcagtaggtaataaattagctggaaaagggtatgagagtaatagctgttacaaaaattgt
gatatttagtttttagatatacacaatattcataaagttagagattcatataacaagtta
gtttctgtatgtctttcttcagattagcagataaagtggtttaaagaagttgattctagc
taatggctagaacatatttcttcaataatttagggagctgtaagaatctgctaatctatg
ctggcaaataatcatgttgttgtccattgttctgatggatgggatagaacttcttaactg
tgttccttggctcaaatattcttagatccttattatagaacaattgaaggattctgctct
ctaatatagaaggattgggtttattttggtcattaatttaatttaaggtaagggcacggg
taaagaaatcaaagtgaggaaacttcacctatatttttataatttttagactgtgtacac
taagtttagaattactatcccctttcatttgaatttaatgaataatttttagttgattta
gcttttagctcctataactgctaatatggtactttccttgctaactcatattaagaactt
gttaaataagacataataaaataaactatttctgtttggagctttcttctttcaaaaagg
cacatttatgaaaatcccttctataaaaaagatgattaaattcaaactttaaagccagat
ttctaacagagatctctcaaaatatggaatagatatttctttttttatcaattttaaaga
ctagatgaatacaagatagaacagtaaaaatgcagatttaatgaggataacatttaaaac
taacataaaaaatcttaagaagcactataattttatgaatcccttttaaaagaattaaaa
atataaataccaaagtaaagagtaacaccaaaagatctagcaaacttagttaaacaatcc
ataattaaagattacgaagcttagtaagtttttaaataagactctgagtataatgaagaa
gattatgatataatactaaagcagtcatcacatatagtaaattaaaacagcagatagatg
aactga

DBGET integrated database retrieval system