KEGG   Tetrahymena thermophila: TTHERM_00388400Help
Entry
TTHERM_00388400   CDS       T01020                                 

Definition
(RefSeq) glucokinase
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase ROK Tape_meas_lam_C E7
Motif
Other DBs
NCBI-GeneID: 7838825
NCBI-ProteinID: XP_001019344
TGD: TTHERM_00388400
UniProt: Q23RE9
AA seq 409 aa AA seqDB search
MLTALSKILNQHQSEYKPSTNKLSQTGEIIYKALIGDIGGTNIRLRLISFTKHARIPTVI
KSSENMKTNQFNSFTDAIAKFLEGVEEIDWPEFAGIGMAGAVLDNQNTLTNAPHWPKIIG
NELAQQFKIKKFQLFNDFEVASYACLNLTKEEVIQINTAQEIPNKIKTVCGAGTGLGVAN
IIPYPKYPESSEYVYQVWPGEGGHGSFAPITKTQQEFVDFLLKYFPERTQIALEYAFVGP
AIPYMYAFFKNRHQGSELALEKAEGAHHSFDVDEYHRMKRSKDEKEREKANFPSHLIFEY
GVQAKDAICEEVVKFFVSIYETAIGDMAVRNLPYSGIYLVGSMSLAVLPYIQKNQATFMK
EYYDNRPYLKDVFDKIPIYIVKEKDIGLDGAYVVTRQMVQSYLSSIPAQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgttaactgcactttcaaaaattttaaattaacattagtctgaatacaagccatccact
aacaagttgagctagactggtgaaatcatctacaaagctcttattggtgatattggtggt
acaaatattcgtctcagacttatttcttttactaagcatgcaagaatccctactgttatt
aagtcaagtgaaaatatgaaaactaaccaatttaactccttcactgatgctatcgctaaa
ttccttgaaggtgtggaagaaatcgactggcctgagtttgcaggtatcggtatggctggt
gctgttcttgataactaaaatactctcaccaatgctcctcattggcccaaaattattggt
aatgaacttgcctagtaattcaaaattaagaagttctaactctttaatgacttcgaagta
gccagttatgcttgtctcaacttaaccaaagaagaagtcatccaaattaatactgcttag
gaaatacccaacaaaattaagactgtttgtggtgctggtactggattaggtgttgctaat
atcatcccttatcctaagtatcctgaaagctctgaatatgtctattaagtatggcctggt
gaaggtggtcatggatcttttgctcctattaccaaaacttaataggaattcgttgacttc
ttattgaaatacttccctgaacgcacttaaattgctttagaatatgccttcgtaggtcct
gctattccctacatgtatgctttcttcaaaaatagacattaaggttcagaattagcttta
gaaaaggctgaaggagctcaccacagctttgatgttgatgaataccacagaatgaagaga
agtaaagatgaaaaggaaagagaaaaggctaacttccccagtcacctcatttttgaatat
ggtgtttaagcaaaggatgcaatttgtgaagaagttgttaaattctttgttagcatatat
gaaactgctattggtgatatggctgtaagaaatttaccttattcaggtatctacttagtt
ggcagcatgagtttagctgttcttccatacattcaaaagaactaagctaccttcatgaag
gaatactatgacaacagaccctacttaaaggatgtctttgataagattcctatttatatt
gtaaaagaaaaggatattggtctcgatggtgcatacgttgtaactagataaatggtacaa
tcatatctttcatcgattcctgcctagtga

DBGET integrated database retrieval system