KEGG   Tetrahymena thermophila: TTHERM_00394500
Entry
TTHERM_00394500   CDS       T01020                                 

Definition
(RefSeq) ergosterol biosynthesis ERG4/ERG24 family protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tet  Tetrahymena thermophila
Pathway
tet00100  Steroid biosynthesis
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TTHERM_00394500
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TTHERM_00394500
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 7822718
NCBI-ProteinID: XP_001011922
TGD: TTHERM_00394500
UniProt: Q233A3
AA seq 371 aa
MSVFDLVQPVTKESILESSLYFGLFFLFQFLGAKFFPSISGYGFPTPQKTRKDYELTGLQ
MFFVTQITYIVARILFGFSLEILIRNFWSFFTVVNVFSIGFSIFLYIKGKLNKSPKFENT
SFLPDFLFEFWCGMELNPTLFGVDLKMFFYQPSLLGMHLFVISFAEYQHTRYGLSTQMIL
LQVFIWLYLFTHYIKEEFMLSTWDIIEEHFGFMLVWGDMIYVPFWYSVVGWFVADSTENY
GMPYYLFVVLLHLFGHFIFRVSNWQKYVYKRYGKNSTFLGQKCVLLEDRLLISGFWGIGR
HLNYSGEIITYLTFALTSRLTSFVPYILPFSLLILLSQRAWRDDQRCSSKYKELWQKYCK
IATFKMIPGVY
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgagtgtttttgatttagtttaacctgttacaaaagagtctatcttggagtcttcgctc
tactttggtttgtttttcttgttctaatttttaggtgccaaattctttccttctatttca
ggttatggctttccaactccttagaaaacgagaaaagattatgaactcactggattgcag
atgttttttgtcacttagattacttatattgttgcaagaattttatttggattttcgttg
gagatattgattagaaatttctggtcattctttacagtagtgaatgtattttctattggg
ttttctattttcctttacataaaaggtaagttgaacaagtctcctaaatttgaaaataca
agctttttgcctgatttccttttcgaattttggtgtggaatggaattaaatcctactctt
tttggagtagatttaaaaatgtttttttactaaccttcgcttttaggcatgcatctcttc
gtaatcagctttgctgagtaccaacacactcgttatggtctatcaacttagatgatatta
ctttaagtctttatttggttatatctttttactcattacataaaagaagaatttatgctc
tcaacttgggatattattgaggaacactttggatttatgctagtttggggagatatgatc
tatgttcctttttggtatagcgttgtaggatggtttgttgctgatagcactgaaaactat
ggtatgccctattatttattcgtggttcttttgcatttgtttggtcattttattttccgt
gtctctaattggtagaaatatgtatacaagagatatggtaaaaattctactttcttaggt
taaaaatgcgttctcctggaagacaggcttttgattagtggtttctggggtattggtcgc
catttaaattactcaggagaaattataacttacttaacttttgccttgacaagtagacta
acaagttttgttccatatatattgcctttctctttacttattttattatctcaaagagca
tggcgtgatgactaaagatgctcatcaaaatacaaagaattatggtaaaaatactgtaaa
atagcaactttcaagatgattccaggagtctattga

DBGET integrated database retrieval system