KEGG   Tetrahymena thermophila: TTHERM_00431210
Entry
TTHERM_00431210   CDS       T01020                                 

Definition
(RefSeq) ubiquitin interaction motif protein
  KO
K12842  U2-associated protein SR140
Organism
tet  Tetrahymena thermophila
Pathway
tet03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tet00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TTHERM_00431210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tet03041]
    TTHERM_00431210
Spliceosome [BR:tet03041]
 Complex A
  U2 snRNP components
   U2 related factors
    TTHERM_00431210
 Complex B
    TTHERM_00431210
SSDB
Motif
Pfam: Surp CID CTK3 RRM_1 YlzJ
Other DBs
NCBI-GeneID: 7847008
NCBI-ProteinID: XP_001011346
TGD: TTHERM_00431210
UniProt: Q231D8
AA seq 967 aa
MKQTCVVPGGKPAQAKFDMETKKILESYEREFGCDETDFKPKTQQPPLFIRGGVQGSDNK
VTENVEKGSFYTPSTQLQKQAENEELNMVNEEELNPYLKYENMSMSMKKNEKTKNQVDEF
FSHLKNKNQNPMQLQSRSKSSTKPEQKMPIVKEMEKRDLFKESAYDSIDNVKRYQSHVFT
DKSIPTLCLQNLELEEDETYLLQIFQKYGKIKFIKRRAIYFPEQLEAEILAYISYEDLSS
AKAAMEGVLQANPQLKFTVRYGYEPESELGDLYKMLAHQYQQTSNFEADSNTRFNEQLSK
ISVFQYPEQGEEKIIHIEPPKNEFIRKLVDKTAKYVIQEGFWFEEKLKESEKKNKEFAFV
FINNCYEHQYYKWRLYSQSQGDDEKSWSMDPFKLSTNGPIFYPPYTEEMQKEREKRISKR
TPQGLSPIPFKERDELEQTLRQLSCLKTSIADAMILVMDLHNSAADVVNTIYQACLCMKN
NMNQMIALVYLISDVLHNSFQIVWQFRLYLEWALPDILEVLNYTYRYNLERDAIGAQNFK
EKVLRVLQVWNDWANFDSNYMNGLEIIFNSEPLDFILHKMNSVTNHITFRLQVYWEQIQQ
IPYDKLERESHNQGVSSRGSIRQIFNRLIVIEYYRLQRQLKGNSEDIQKFSKEEAIQQMQ
RFNKNVINTVDHDYMKKELVEEWTNIGLSLLIYIQDKNKFIDENDIDGQPITEFDEIFLE
IKNISKPQEPEVSNDIFQIIEEEKGEEYKESEINGIPLTAEEIKNIQNNTYQVISEFEIS
FLTKPIPAQRVHTTPLQQASSSSSKKLQSQNQEDERKTQPKTTQQQQSSSTAPIQIGQKY
QKMNVPSISSYKQEKSNIYSQSAAGFARLRGNSKRNESSSSSSSRSRSRGRKQSTKDNKK
DSRSRSKSSRKSSKNLKKGDRKGKYSSSSSSSSSSSSSSSSSSSRSNSKDSKNKRRKSQY
DKNQKKR
NT seq 2904 nt   +upstreamnt  +downstreamnt
atgaagcaaacttgcgttgttcctggtggaaaaccagcttaagctaaatttgatatggaa
acgaaaaaaattttagaaagctatgagagagaatttggttgcgacgaaacagattttaag
cctaaaacttagcagccacctctatttattaggggaggagttcaaggatcagataacaaa
gtcacagagaatgttgaaaaagggtctttttatacaccaagcactcagctataaaagtaa
gccgaaaatgaagaacttaatatggtcaatgaagaagaactcaatccttatcttaagtac
gaaaatatgagcatgagtatgaagaaaaatgaaaagactaaaaactaagtagacgagttc
ttttctcatctgaaaaacaagaactaaaacccaatgtagttgcaatcgaggtctaaatct
tctactaagcctgaatagaaaatgcctattgtcaaagaaatggaaaaaagagatttattt
aaagagtctgcatacgattcaattgacaatgtcaaaagatattagtctcatgtgtttaca
gacaagagtatcccaactctctgcttataaaacctagagcttgaagaggatgagacttat
ctccttcaaatattttaaaagtatggcaagataaaatttattaaaagaagagcaatctac
ttccctgaataacttgaagctgaaattcttgcatatatttcatacgaagatttatcttca
gctaaagctgcaatggaaggagtactttaggcaaatcctcaattaaaatttacagtgaga
tacggctacgaaccagaaagcgagcttggagatctttacaagatgctagctcatcaatat
caacaaacttccaattttgaagctgactcaaatacaagattcaatgaacaacttagcaaa
atttcagtattccaatatcccgagtaaggagaagaaaagatcattcacattgagcctcca
aaaaatgaatttatacgtaaattagtagacaaaacagctaaatatgttattcaagaggga
ttttggtttgaagaaaagcttaaagaatctgagaaaaagaataaagaatttgcatttgtt
ttcattaacaattgctacgagcaccagtattataaatggagactttattcacaatcatag
ggcgatgatgaaaaatcctggagtatggacccatttaaactatctacaaatggacctatt
ttctatccaccctatacagaagagatgtagaaagaaagagaaaaaaggatatctaaaaga
accccgtaaggtctatctcctattccttttaaggaaagagatgaactagaacaaactttg
agatagctgagctgtttaaagacgtcaattgcagatgctatgattttagttatggatcta
cataattctgctgcagatgtagtaaatactatctactaagcttgtctatgcatgaaaaat
aacatgaattaaatgattgctttggtttatttgatttctgatgtcttgcataacagtttt
tagattgtctggtaatttcgtttgtatcttgaatgggctctgccagatattttggaggtt
ctaaattacacttacagatataatttagagagagatgcaattggggcacaaaactttaaa
gagaaagtacttcgtgttttgcaggtgtggaatgactgggctaatttcgattcgaattat
atgaatgggttggagattatctttaattctgagcctttagattttattttgcacaaaatg
aactcagttacaaatcatataacctttagattgtaagtttattgggagtaaatttaatag
ataccttatgataagttagaaagagagtctcacaatcaaggtgtaagctcaaggggtagt
atcagataaatattcaaccgcttaatagttattgagtactacagactttaaagacagcta
aaagggaatagtgaggatattcaaaaatttagcaaggaagaagcaatttagcagatgcaa
cgcttcaacaagaacgtcatcaatacagttgaccatgattatatgaaaaaggagttagtt
gaagagtggacaaatattggtctctctttgctaatttacattcaagacaaaaataaattt
attgatgaaaacgacatcgatggatagccaataacagaatttgatgaaatcttcttagaa
ataaaaaatatttcaaaacctcaagagcctgaagtgtctaatgatatattttagatcata
gaggaggagaaaggtgaagaatacaaggaatcagaaataaacggtattccattaacagca
gaagaaatcaaaaatatttaaaataatacctactaagtcatttctgaatttgaaatatca
ttcctcacaaaacccataccagcctaaagagtgcacacaacgccactgcaacaagcatct
tccagctcttccaaaaagctctaatcacaaaaccaagaggatgaaagaaagacctagcca
aaaactacttaatagcagtaatcttcaagtacagcacctatatagattggataaaaatat
caaaagatgaacgttccctctattagctcttataagtaagaaaaatcaaacatttattct
tagtcagctgcaggtttcgccagacttagaggaaatagcaaacgtaatgagtctagttca
tcttctagctcaagaagtagaagcagaggtagaaaataatcaacaaaagacaataaaaag
gatagtagaagcagatcaaaatcctccagaaaaagttctaaaaatttaaaaaagggagac
agaaaaggaaagtattcttcaagttccagctcttcatcttcatcttcgtcatcgtcttcc
tcttcttcttctagatctaattctaaagactccaaaaataaaagaagaaaaagttaatat
gataaaaactaaaagaagagatga

DBGET integrated database retrieval system