KEGG   Tetrahymena thermophila: TTHERM_00516420Help
Entry
TTHERM_00516420   CDS       T01020                                 

Definition
(RefSeq) glutathione S-transferase, amine-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tet  Tetrahymena thermophila
Pathway
tet00480  Glutathione metabolism
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TTHERM_00516420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tet02000]
    TTHERM_00516420
Enzymes [BR:tet01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TTHERM_00516420
Transporters [BR:tet02000]
 Other transporters
  Pores ion channels [TC:1]
   TTHERM_00516420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_6 GST_C_2 OEP GST_N_3
Motif
Other DBs
NCBI-GeneID: 7826955
NCBI-ProteinID: XP_001015253
TGD: TTHERM_00516420
UniProt: I7MIV6
AA seq 215 aa AA seqDB search
MIILGYWNLRGYGQSIRLLLEYLQVEYQDKLYHENGEEWFGTDKKNLNTNFPNLPYVIDG
DVVVTESKVIPIYIIKKFKRFDLIGQNVDGSYNQNEITYLQLQEILKELLDKLEAQARIP
SFKEEKEKIFNEQFNITFEKIKKQLGNQEYLLGNLTYVDLYFYEVLRNFQLFYPKIQIFT
EYLKRIENIPQIKEYIQTKENKTFIFDSMKDKYYY
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgataatacttggatattggaacttaagaggttacggataatctatccgcttgctgctt
gaatatttgtaagtggaatattaggataaactttatcatgagaatggagaggagtggttt
ggtacagataagaaaaatctcaatacaaacttccctaatttaccctatgttatagatgga
gatgtagttgtgacagaatctaaagttattcctatctatattattaagaagttcaagaga
tttgatcttattggatagaatgttgatggttcttataattagaatgaaattacttatcta
caactttaggagattttaaaggaattattagataaacttgaagcttaagcgagaatcccc
tcattcaaagaagagaaagaaaagattttcaatgaacaatttaatattacgtttgaaaaa
attaagaaataacttggaaatcaagaatatctattaggtaatcttacatacgtagatctt
tacttttacgaagttttaagaaatttctaattattttatcctaaaatctaaatttttact
gagtacctgaaaagaattgagaatattcctcaaatcaaggaatacattcaaactaaagaa
aacaaaacattcatttttgattccatgaaagataaatattattactga

DBGET integrated database retrieval system