KEGG   Tetrahymena thermophila: TTHERM_00530750Help
Entry
TTHERM_00530750   CDS       T01020                                 

Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tet  Tetrahymena thermophila
Pathway
tet00010  Glycolysis / Gluconeogenesis
tet00020  Citrate cycle (TCA cycle)
tet00620  Pyruvate metabolism
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
tet01130  Biosynthesis of antibiotics
tet01200  Carbon metabolism
Module
tet_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHERM_00530750
   00020 Citrate cycle (TCA cycle)
    TTHERM_00530750
   00620 Pyruvate metabolism
    TTHERM_00530750
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TTHERM_00530750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C RnfC_N DUF2859
Motif
Other DBs
NCBI-GeneID: 7835389
NCBI-ProteinID: XP_001032780
TGD: TTHERM_00530750
UniProt: I7LZY0
AA seq 628 aa AA seqDB search
MISSTRLLKRASNYLKQAARYSMSTVQKGKKTSFKAPLYQINFQSQSLSQNITYNFSSYP
KHRLVALPALSPTMTEGKIAAWHIKVGQKIQEGDNIFDVQTDKDSVPNVYQEETGFVAKI
LVNEGELIPANTPVVVVCKSEADIPAFANFTVGGAQKAQEAPKQEQPKPAAQTAAKPAPA
ASSGASFPKHNVVLLPALSPTMTEGKIASFHVKVGDKVTEGDNIFDVQTDKDSVPNIYQE
ASGFVAKILVKEGETIPANHPVLVVVAKKDDLAKFEQFTLNDALKKGSASSAPQEAAQPA
QTSSAQTATQTTVASGSSGRVAASPYAKTVAQEKGVDLSTVQGSGPNGRIIAKDVQNATT
KAAQQTVAAQQPAAETKQEAPKPAPQQPKVEVVVQGGVEYQKIPITPMRKTIAERLVQSK
TTVPHFYLNIDVQMDEVLHLRKTLNEQSTSKISVNDLIVKASALALRDMPGVNSQWHGDH
IRQFKHADVAVAVSTKTGLITPIVFNAETLGLSQISSKTKELAEKARKGGLLPTEYQGGT
FTISNLGMYGIDHFAAIVNPPHGTILAVGATSQKVVPDNDPHAKYPFKTIQSMTVTLSCD
HRVVDGALGAEWLQKFKGYLEKPYTMLL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttcaactagacttttaaagagagcttctaactacttaaagcaagctgcccgt
tattcaatgtccacagtttaaaagggcaaaaagacttccttcaaggcacctctctatcaa
atcaatttctaatcctaatctttgtcatagaatattacctacaacttctcaagttatcct
aagcatagacttgtcgctttacctgctctctctcctaccatgactgaaggtaaaattgca
gcctggcacatcaaggttggctaaaagatctaagaaggtgataatatcttcgatgtctaa
actgataaagactctgtaccaaatgtttaccaagaagaaactggttttgttgccaagata
ttggtcaacgaaggtgaattgattcctgctaacactccagtcgttgttgtttgtaagtct
gaagctgatattcctgcctttgctaacttcactgtaggtggagcccaaaaggcttaggaa
gcccctaagtaagaatagcccaagcctgctgcctagacagctgctaagcctgctcctgct
gcctcttctggtgcttcattccctaagcataatgtcgtccttcttcccgccttatctcct
accatgactgaaggtaaaatagcttccttccatgtaaaagttggagataaagtcactgaa
ggtgacaacattttcgatgtttaaactgataaagactcagtcccaaatatttactaagaa
gcatcaggatttgttgctaaaattttagttaaggaaggtgaaacaatccctgccaaccat
cctgttttagttgttgtcgccaaaaaagacgatcttgctaagtttgaataattcacatta
aatgatgctttgaaaaagggttctgcttcttctgccccctaagaagctgctcaacctgct
caaacttcttctgcttaaactgccacataaactaccgttgcttctggatcttctggaaga
gttgctgctagtccttatgctaaaactgttgcttaagaaaagggagttgatctttcaact
gtttaaggttctggtcctaatggccgtattattgccaaggacgtataaaatgctacaact
aaagctgctcaataaactgttgctgcttaataacctgctgctgaaaccaaataggaagct
cctaaacctgctccttaataacctaaggtagaagttgttgtttaaggaggtgttgaatat
caaaagattccaattactcctatgagaaaaacaattgctgaacgtttggtctaatctaag
acaactgttcctcacttctatttaaatattgatgtttaaatggacgaagttcttcattta
cgtaaaactttaaatgaacaatctacttctaagatctcagtcaatgacttaattgttaag
gctagtgctttagctcttagagatatgccaggagtcaattcccaatggcacggtgatcac
attcgtcaattcaagcatgctgatgttgctgttgcagtatcaactaagactggtttgatt
actcctattgtttttaatgctgaaactttgggactttcttaaatctcttctaagactaaa
gagttagctgaaaaggctagaaagggaggacttcttcctactgaatattaaggtggtact
ttcactatctctaacttgggtatgtatggtattgaccatttcgcagctattgttaatcct
cctcatggtactattttagctgttggtgctacttcataaaaggttgtccctgacaatgat
cctcatgctaaatatcctttcaagactatttaatcaatgactgtaactttaagttgcgat
catagagtagtcgatggtgctcttggtgccgaatggttacaaaaattcaaaggttacctc
gaaaagccttacactatgcttctttga

DBGET integrated database retrieval system