KEGG   Tetrahymena thermophila: TTHERM_00532800Help
Entry
TTHERM_00532800   CDS       T01020                                 

Definition
(RefSeq) cytochrome C domain protein
  KO
K08738  cytochrome c
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-GeneID: 7830401
NCBI-ProteinID: XP_001024401
TGD: TTHERM_00532800
UniProt: Q247Y9
AA seq 152 aa AA seqDB search
MSQQTMRNNVQIIGDHKYKYRKFQVNPDYQDIDIPDGDPIRGEWIYKNYCAGCHDLDSEQ
LQGPSLRQVYMRKAGTRKGYRYYSSTMPSYHFYWTRNILDQFIENPEKTFPDTNMFFDGL
RDSYDRACIIEYLHYLRAETDGAQRKLSRKII
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcataataaactatgaggaacaatgtttaaattataggtgatcataaatataaatat
agaaaattttaagtaaatcccgattattaagatatcgatattcctgacggggatcctata
agaggagagtggatttataaaaactactgtgctggttgccacgatttagattctgaataa
ttgcaaggtccttctttgagataagtttatatgcgaaaagcaggaacaagaaaaggatat
agatactattcatctacaatgccatcatatcacttttattggacaagaaatattctagac
tagtttattgaaaatccagaaaaaacttttcctgacacaaacatgttttttgatggttta
agagacagctatgacagagcttgcataatagagtatctacactacctccgagctgaaact
gatggggcataaaggaaactatcaagaaaaataatttga

DBGET integrated database retrieval system