KEGG   Tetrahymena thermophila: TTHERM_00535260Help
Entry
TTHERM_00535260   CDS       T01020                                 

Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] subunit beta
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
tet  Tetrahymena thermophila
Pathway
tet00020  Citrate cycle (TCA cycle)
tet00640  Propanoate metabolism
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
tet01130  Biosynthesis of antibiotics
tet01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTHERM_00535260
   00640 Propanoate metabolism
    TTHERM_00535260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tet04147]
    TTHERM_00535260
Enzymes [BR:tet01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     TTHERM_00535260
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TTHERM_00535260
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTHERM_00535260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Phage_Orf51
Motif
Other DBs
NCBI-GeneID: 7843866
NCBI-ProteinID: XP_001023435
TGD: TTHERM_00535260
UniProt: I7MLW4
AA seq 429 aa AA seqDB search
MFSKLFNFGKTVQLQNTCKRFFDLHEYQSKDIMRKFNIRVQKGDIALTPEQARKVAEPLD
PTGGLILKAQVHAGGRGKGHLTSGLKGGVKVLKTPQEVETYTKQMIGYNLITHQTPKAGL
RVDAVLVHEGVDIVRQIYLAFILDRNSQKPAIVASVNGGVDIEEVAKTHPESIIVQPICP
SAGLTDADLNTVISKLQLTHIAEDAKTQIKNLYQMFNKLDATQVEINPWATDPKDKLYCV
DAKINIDDNAKFRQQELVQLRKNSVASEDVDPHEEKAIQAGLAYVALDGNIGCLVNGAGL
AMGTMDIIKLCGGSPANFLDVGGGANVEQVKTAFEILNAHPKVETVFINIFGGILSCKLI
AEGIIKAAQLVSLRVPLVVRLSGNQADVGRKLLLEFTDKNPSIKIRVGQDLGDSAELAVK
TANEFAGRH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttctctaaattgttcaacttcggcaagaccgttcaactctaaaacacttgcaaaaga
ttctttgatttgcatgaatattaatctaaggatatcatgagaaagttcaatatcagagtc
taaaagggtgatatcgctttgactcctgaataagcaagaaaagtcgctgaaccccttgac
ccaactggtggtcttattcttaaggcttaagtccatgctggtggtagaggaaaaggtcac
ttgacttctggtttaaagggtggtgttaaagttcttaagactcctcaagaagttgaaacc
tacactaagtaaatgattggttataacctcatcactcaccaaacccccaaggctggtttg
agagtcgatgctgtcttagtccacgaaggtgttgacatcgtcagacaaatctacttagct
ttcattttagatagaaactctcaaaaacccgctatcgttgcttctgttaacggtggtgtt
gatattgaagaagttgctaaaactcaccctgaaagcatcatcgttcaacccatctgccct
tctgctggtttgactgatgctgacttaaatactgtcatttccaagttataattaactcac
atcgctgaagatgctaagactcaaattaaaaacctctattaaatgttcaacaagctcgat
gctacccaagttgaaatcaacccttgggccaccgatcctaaggacaagctttactgcgtt
gatgctaagattaacatcgatgataatgccaaattcagacaataagaattagttcaatta
agaaagaactccgttgccagtgaagatgttgatcctcatgaagaaaaggccatccaagct
ggtttggcttacgttgctcttgacggtaacattggttgcttagttaacggtgctggtttg
gctatgggtaccatggatatcattaagttatgtggtggttctcctgctaacttcttagat
gttggtggtggtgctaacgttgaataagttaagactgctttcgaaatcttgaacgctcac
cctaaggtcgaaaccgtctttattaatattttcggtggtatcctttcttgcaagctcatt
gctgaaggtattatcaaggccgcctaattagtttctttgagagttcctttggttgttcgt
ctctctggtaactaagctgatgttggtagaaaattactcttagaattcaccgataagaat
ccctctattaaaattagagtcggataggacctcggtgactctgctgaactcgctgtcaag
actgccaacgaatttgccggaagacattga

DBGET integrated database retrieval system