KEGG   Tetrahymena thermophila: TTHERM_00549480Help
Entry
TTHERM_00549480   CDS       T01020                                 

Definition
(RefSeq) protein disulfide isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tet  Tetrahymena thermophila
Pathway
tet04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TTHERM_00549480
Enzymes [BR:tet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TTHERM_00549480
Chaperones and folding catalysts [BR:tet03110]
 Protein folding catalysts
  Protein disulfide isomerase
   TTHERM_00549480
Membrane trafficking [BR:tet04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    TTHERM_00549480
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TTHERM_00549480
  Exosomal proteins of colorectal cancer cells
   TTHERM_00549480
  Exosomal proteins of bladder cancer cells
   TTHERM_00549480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_7 Thioredoxin_8 AhpC-TSA Thioredoxin_2 Redoxin Thioredoxin_4 TraF HATPase_c_4
Motif
Other DBs
NCBI-GeneID: 7822794
NCBI-ProteinID: XP_976697
TGD: TTHERM_00549480
UniProt: I7M0B1
AA seq 490 aa AA seqDB search
MNVFVIGIIYLIFVLTAIVASLLTIQEKLKFDDENGVLILTDKNFKFALEQHDFIMVEFY
APWCGHCKSLAPQYEKAAQQLKDGNSKAVLSKVDATAEKFVASQFTIQGYPTLKFFIKGK
SIEYKGGRTTNDIVAWIERKTGPPSQLVSNPSDLQDIIKDNDVVLAYFGDSEEDKEYKIF
ESICLTYDHVKFVHSFDSATKDSVKGTFKNVKLFKNYDERENDFGQQQFTAEKLGKFIDD
FSHPLVFPWGDTASSKIYSDKNIGVLLFREAFDQSSLLVLQEIAKTRKLKEQIQFAQVDK
QHKEYSRISENIGATGLNLPAVFIVDPNEENATYLMEGEELNIKNLDRFINNFKNKRLTK
YIKSLPIPENTGTAVQTIVRKNYDQVVRASNKDLLIMYFATWCGHCNQFKPKYEELAKRF
VENTNLVFAMYDGVNNAVEDVQVNSYPTLYFFKNGSKASPVKYEGNRDADDLIQFVKKHT
THPWVQPSAQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtattcgtaataggtatcatctatctaatatttgtgttaactgcgattgtagca
tcgttgttaaccatctaagaaaagcttaagtttgatgatgaaaacggcgtactcatctta
acagataaaaatttcaaatttgcactcgagtagcacgattttatcatggttgaattttat
gctccatggtgcggtcactgcaaaagcttggctccttaatatgaaaaagctgcataataa
cttaaggatggtaactctaaagctgttctttccaaggttgatgcaactgctgagaaattt
gttgcttcccaatttactatttaaggatatcctactttgaaattcttcatcaagggtaaa
tccattgaatacaagggaggaagaactacaaatgatatcgttgcatggattgaacgtaaa
actggtcccccttctcaattagttagcaatcctagcgatctctaagacatcattaaagac
aacgatgttgttttggcttatttcggtgattctgaagaagataaggaatacaagattttt
gaatctatctgcttgacatacgaccatgttaagttcgtccattcttttgactcagctacc
aaggattcagttaagggtacttttaagaatgtcaaattattcaagaactacgatgaaaga
gaaaatgactttggtcaataataattcactgccgaaaaattaggaaagttcattgatgac
ttctctcatcctttggttttcccttggggagacactgcctcatcaaagatatattctgat
aaaaacatcggtgtccttttgttcagagaagctttcgactaatcttctttattagttctc
taagaaattgccaagactagaaaattgaaagagtagattcaatttgcttaggttgataag
caacataaggaatactcaagaatcagtgaaaatattggtgctactggcttaaaccttcct
gcagtcttcatcgttgatcctaatgaagaaaatgctacttacttgatggaaggagaagaa
ttaaatattaagaatttggatagattcattaacaactttaagaacaagagattaactaag
tatatcaagtctcttccaattcctgaaaacactggtactgctgttcaaactattgtcaga
aagaattacgactaagttgtccgtgcttctaacaaggatttacttattatgtactttgct
acctggtgtggtcattgcaatcaattcaagcccaagtatgaagaattagctaaaagattt
gttgaaaacacaaatcttgtttttgctatgtacgatggtgtaaataatgccgtagaagat
gtccaagttaatagttatcctacactctacttctttaaaaatggttccaaagcctctcct
gtaaagtacgaaggtaaccgtgacgctgatgatttaattcaatttgttaagaaacacaca
actcacccatgggtttaaccttctgcttaatga

DBGET integrated database retrieval system