KEGG   Tetrahymena thermophila: TTHERM_00560000Help
Entry
TTHERM_00560000   CDS       T01020                                 

Definition
(RefSeq) cysteinyl-tRNA synthetase protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
tet  Tetrahymena thermophila
Pathway
tet00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tet00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTHERM_00560000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tet01007]
    TTHERM_00560000
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tet03016]
    TTHERM_00560000
Enzymes [BR:tet01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     TTHERM_00560000
Amino acid related enzymes [BR:tet01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TTHERM_00560000
Transfer RNA biogenesis [BR:tet03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TTHERM_00560000
 Prokaryotic Type
    TTHERM_00560000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1c tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 7834868
NCBI-ProteinID: XP_001010154
TGD: TTHERM_00560000
UniProt: I7LU51
AA seq 716 aa AA seqDB search
MIKQITNLTKTLKKRFLQVPKYPFGNSCCNKNLQIANLFSTNQKMTTEVKKDPYQLWQLP
VKDETKYLTGLKVKNTLNPQNLVEFVPHKGKQVRFYNCGPTVYDSSHIGHARTYISADII
KRIMVKYFGYDVFHCMNITDIDDKIIKKSNESGEEFTAFARKWEMDYWQDMETLNVDKPD
VIVRVSEYVPEIISYIEKIIENGYAYVANGSVYFNVDKFHESPTHCYSKLEPQSVNDAQK
LDEGEGALGKKDEKEKRSPRDFALWKASKPGEPFWDSPWGQGRPGWHIECSTMASEILGY
PVDIHMGGEDLKFPHHDNELAQSEAFYNKQDCQNQWVNYFMHTGHLHIDGLKMSKSLKNF
ITIKHLSSQHSQRVLRLLFMKQTYDSTMDYTTDSIHEAKTKDKKYSEFYLTMNAILLQSE
INVPQKWGPREFELRDLFVEKQDNIHRAFQKNFNVPEALKELDEIITAVNTYIKEKPIIH
LLIRSIFNYVKHIFNCLGLIYEKQQAQAKDDTFIRTVGLISSLRDEIRGANKDLQVINKA
AINAKSSLGEITLKLEPNASESAVQIATDYITQVLKCVEDNQLQQIYKASDEIRDEKLIQ
IGIRIDDGKPGEPSLWKIDDKETLLKEKEEKILKEKQKEEEKRKKEEEKLKAMSVNPAEM
FKNDPNYSKYQFDERGIPSHDEKGTPLKEKAIQSFVKKYDAQKKLYEQYLEKTSKK
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatagattactaatctaacaaaaacattaaaaaaacgatttttgcaagtgcca
aaatatccttttggaaatagctgctgcaacaagaatttataaatagcgaatctcttctct
actaattaaaaaatgacaactgaggtaaaaaaagacccctatcaattatggcaactccct
gttaaagatgaaaccaagtatttaacaggtcttaaagttaaaaacaccttaaatccttag
aatttagttgaattcgtccctcacaaaggcaaataagttagattctacaactgtggccct
acagtttatgattcttcacacattggtcatgccagaacttacatttctgcagatattatc
aaaagaattatggttaagtactttggctatgatgttttccactgtatgaatattactgac
atagatgacaagatcattaaaaagtcaaatgaaagtggtgaagaatttactgcctttgcc
agaaaatgggaaatggattactggtaagacatggaaacattaaatgttgataagcctgat
gtcatagtcagagttagcgaatatgtaccagaaattatttcttacattgaaaaaattatt
gaaaatggctacgcttatgtcgctaatggctccgtttacttcaatgttgataaattccac
gagtctccaactcattgctactctaaactcgaacctcaaagtgttaatgatgcttaaaag
ctagacgaaggtgaaggtgctcttggcaaaaaagatgaaaaggaaaaaagatctcctaga
gactttgctttgtggaaagcaagcaaacctggtgagcccttctgggatagtccttggggc
taaggtcgtcctggatggcacattgaatgttcaactatggcctccgaaattcttggatat
ccagtcgatatccatatgggaggagaagacttgaaattccctcaccacgataacgaattg
gcttagagtgaagccttttataataaataagattgctaaaatcaatgggttaactacttc
atgcatacaggccatttgcacattgatggattaaaaatgtcaaagagtttaaaaaatttc
attaccattaagcatttatccagccaacacagctagcgcgttttaagacttctctttatg
aaataaacatatgactctacaatggattacaccactgattcaatacatgaagctaaaaca
aaagataaaaagtattcagaattttatcttacaatgaacgccatacttctttaatcagaa
atcaatgtcccatagaagtggggtcctagagaatttgaattaagagacttgtttgttgaa
aagcaagataacatccacagggcattctaaaaaaatttcaatgtccctgaagcacttaaa
gagcttgacgaaatcatcactgctgtcaatacttacattaaggaaaagcctatcattcat
cttctcatcagaagtattttcaactacgttaagcatattttcaattgcttaggtttaatt
tatgaaaagcaacaagcttaagctaaggatgacaccttcattcgcactgttggattgatt
agcagtctcagagatgagatcagaggtgcaaacaaagatttgcaagttatcaacaaggca
gctattaatgctaagtcttctcttggtgaaataaccttaaaactagaaccaaatgctagt
gaaagtgctgtttagattgccacagactacataacttaagtattaaaatgtgttgaagat
aactaactttaacagatttataaggcttcagatgaaatcagagatgaaaaactgatttag
attggtatccgtattgatgatggtaaacctggtgagcccagtttatggaaaatcgatgat
aaagaaactttgctaaaagagaaagaagagaaaatactcaaagaaaaataaaaagaagaa
gaaaagcgcaaaaaagaagaagaaaaattgaaagctatgagtgtgaatccagcagaaatg
tttaaaaatgatcctaactatagcaagtaccaatttgatgaaagaggtattcctagtcac
gatgaaaagggcactcctcttaaagaaaaagctatttaatcttttgttaaaaaatacgat
gcacaaaagaagctctatgaacaataccttgaaaaaacatcaaaaaagtga

DBGET integrated database retrieval system