KEGG   Tetrahymena thermophila: TTHERM_00624110Help
Entry
TTHERM_00624110   CDS       T01020                                 

Definition
(RefSeq) insulin-degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
tet  Tetrahymena thermophila
Brite
KEGG Orthology (KO) [BR:tet00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tet01002]
    TTHERM_00624110
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     TTHERM_00624110
Peptidases and inhibitors [BR:tet01002]
 Metallo peptidases
  Family M16: pitrilysin family
   TTHERM_00624110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 7822935
NCBI-ProteinID: XP_001022537
TGD: TTHERM_00624110
UniProt: Q240X2
AA seq 1152 aa AA seqDB search
MKQNTIVQIDKSPNDDRQYLGFELQNGIKVMVISDSHAEKSAASLDVQVGQLQDPEEYQG
LAHFCEHMLFMGTAKYPLQNEYSQYLSQNGGSDNAYTDILNTNYYFDVKSDAFEEALDRF
SQFFISPLFDETCVEKEINAIENEHQMNVSEDSSRLWGIFKALAKEGTKFRQYGGGCLQT
LQKENIREELLKFYEKYYSAHKMNLVIYGQESIEVLKNLAIKYFSTIQNKEKEQISDEQM
KEMELEKIHPFPREQLCKLVKIIPIKDEDIIEFCWVVEDQQQYCNIKPDDYLTHIFGHEG
KNSLLSLLLDEGLAVELTSYSENCMNLFTIIGFNITLTQRGFFEYKRVCHAVFNYIQVLK
KEVANKEAYEEVKDIEAINFRFLERIAISEYVTKIADGLHWIPMTKILKMRYDFQKYDEI
IIQKLIDSLTLDNIIIYLSSKSFDSQFSKSFNTSQQDLDTVIDSSQVLTKKAQELIETHC
HNHSITHPHGSAAAQKVKKDKELTQEDQASSYDTDQNQLDSHGGESPKLKSPQISARKYS
KSVAKKSYTIEEEFEDFDDENHIYSMLNRKFSYLSQKSETNDGDEEYQDNRSDENFNYAN
AKQNNSKSDDDSFITEKYLGARYLVSEIPEDIKSSYNTEYKPLYSKKKLGLPVKNLFIPK
NFDILPKTDDTSSASKYPIKIFESEMSELYYKQDDTFFICKTYCDLFIFTNDCNQSKTAK
SFVLQEIWLILFENYVNETKYLAQMANIDLKFEQHYTSFKVRIKGYSDKIGVLFEEFLKL
FKSFNPADEGQRLFSTFYERQMSDYDNYYRDAPHSIITDLSKNCLLSTGKFTIKQKIMAL
KEIRLYDIVEFHKQWLSHTRLESLIMGNISKEEAISWIQKAENTMKTLRNIFGILQKSDI
PLIKPNKILPNTTNKLDFLINEKEFNPEETNSCLQSHYQRGPESVESRVMMKLIQNYLSE
PLFNQLRTNEKLGYIVWCWDETFRGVSGFSFLVQSSVCSPMHIQNRLEEFLVNMRKELRQ
LSQEKFENMKHSILIKLTEKPKTLHREFLSMSEEILLHKFVFDRKERIPHILEAITINDL
INDFDNLFFEQKKKLEIHIITNDHKEEQEQLEQERLKQEDIFILQDDTHLKQFCQQIDSL
YYDYSSPVQLQF
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgaagtagaatacgatagtctaaattgataaaagtcctaatgacgatagataatattta
ggttttgaacttcaaaatggtattaaagttatggtaataagtgatagtcatgcagaaaaa
tcagctgcttcacttgatgtttaagttggttaattacaagatccagaagaatattaagga
ttagcacatttttgtgaacacatgctttttatgggcacagcaaaatatcctttataaaac
gaatatagctaatatttaagctaaaatggaggaagtgacaacgcctatactgatatattg
aataccaattactactttgatgttaaatcagatgcatttgaagaagctttagatagattt
agctagttttttatcagtcctctattcgatgagacttgtgtagaaaaagagattaatgca
attgaaaatgaacactaaatgaatgttagtgaagattccagtcgtttatggggaatattt
aaagctctagcaaaggaaggaacaaaatttcgttaatatggaggaggatgcttacaaact
cttcaaaaagaaaatattagagaagaactgcttaaattttatgaaaaatactatagcgct
cataaaatgaatttagtaatatatggtcaggaatcaatagaagtactaaaaaatctggca
ataaaatatttttctacaatacaaaacaaagaaaaagaataaattagtgatgaacagatg
aaagaaatggagttagagaaaattcacccattccctagagagtagctttgcaaattagtt
aaaatcattcccataaaagatgaagatattattgagttctgttgggtagttgaggattaa
taatagtactgtaatataaagccagatgattatttaacgcatatttttggccacgaagga
aaaaattctttgctttctttacttcttgatgaaggattagcagtagaattgacttcttat
tcagaaaattgcatgaatttatttactataattggctttaatatcacattaactcaaaga
ggattctttgaatataaaagggtctgtcatgctgtttttaattatatataagtccttaaa
aaagaagttgccaacaaagaagcatatgaagaggtaaaagatattgaggctataaatttt
cgctttttagagagaatagcaataagtgaatatgtaactaaaattgcagatggacttcat
tggatccctatgaccaaaatcttaaaaatgagatatgatttctaaaagtacgatgaaatt
ataatataaaagctaatagattctctaactttagataatatcataatttatttaagctca
aagagttttgattcacagttttctaaatcctttaacacctctcaataagatttagacact
gtcattgattctagccaggtgctaacaaaaaaagcttaagagttaatagaaactcactgc
cataatcattcaataacacatccacatggttcagctgctgcttaaaaagttaaaaaagat
aaagaattaacttaagaagactaagcttctagttatgatacagatcaaaattaattggat
tctcatggaggagaatctccaaaacttaaaagcccataaatatcagcaagaaaatatagt
aagtctgttgctaaaaaatcttatacaattgaagaagagtttgaagattttgacgatgaa
aatcatatttatagtatgctaaacagaaaatttagctatttatcataaaaatctgaaaca
aatgatggagatgaggaatactaagataatcgtagcgatgaaaattttaattatgctaat
gcaaaatagaataacagcaagagtgacgatgattcattcataactgaaaaatatttagga
gctagatatcttgtaagtgaaattcctgaagatattaaatcttcttataatacagaatat
aagcctctttatagcaaaaaaaaacttggtttacctgttaaaaatttattcattcctaaa
aattttgatatacttcctaagacagatgatacaagtagtgccagtaagtacccaataaag
atttttgaaagtgaaatgagcgaactttattataaataagacgatacgttctttatctgc
aaaacttattgtgacttatttatctttacgaatgattgcaatcaatctaaaacagctaaa
tcatttgtattgcaagaaatttggttaatactttttgaaaactatgttaatgaaactaaa
tatttagctcaaatggctaatatagatttaaaatttgagtagcactacacttcttttaaa
gtaagaataaaaggatatagtgataaaatcggtgtcttgtttgaagagtttttaaagctc
tttaagtcatttaatccagctgatgaaggttaaagattattttcaactttttatgaaaga
taaatgtctgattatgataattactatcgtgatgctcctcactcaattataactgatttg
agtaagaactgtctactttcaacaggaaaatttactattaagtaaaaaataatggcacta
aaagaaataagactttatgacatcgttgaatttcataaatagtggttatcccatactcgt
cttgaaagcttgattatgggaaatattagtaaagaagaggcaatatcttggatataaaaa
gctgaaaacacaatgaaaactttgagaaacatttttggaatactacaaaaatccgacata
cctttgattaaacctaacaaaattcttccaaacaccacaaataaacttgattttctaatc
aacgaaaaagaatttaatcctgaagaaaccaactcatgcttataatcacactactaaaga
ggtccagaatcagtagaatctcgtgttatgatgaagcttatataaaattatttaagtgaa
cctctctttaattaattgcgtactaatgaaaaactaggttatatagtctggtgctgggat
gagacatttagaggagtgagtggattttcattcttagttcaatcctccgtttgctcacct
atgcatatctaaaatagacttgaagagtttttagtaaatatgagaaaagaattaagataa
ctttcccaagaaaaatttgaaaatatgaaacattccattctaatcaaactcacagaaaag
cctaaaaccttacatagagaatttctatcaatgtctgaagagattttgttgcataaattt
gtatttgatagaaaggaaagaataccacatattttagaagcaatcactattaatgatctt
attaatgattttgataacttattttttgagtaaaagaaaaaattagaaattcacataata
acaaatgatcataaagaagaacaagaataattagaacaagaacgtctaaaataagaagac
atctttattttataggatgacactcacctgaaatagttctgctagtaaattgatagtctt
tattatgattattcaagtccagtatagttgcaattttga

DBGET integrated database retrieval system