KEGG   Tetrahymena thermophila: TTHERM_00878160Help
Entry
TTHERM_00878160   CDS       T01020                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tet  Tetrahymena thermophila
Pathway
tet00620  Pyruvate metabolism
tet00630  Glyoxylate and dicarboxylate metabolism
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
tet01200  Carbon metabolism
Module
tet_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTHERM_00878160
   00630 Glyoxylate and dicarboxylate metabolism
    TTHERM_00878160
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TTHERM_00878160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase F-box_4
Motif
Other DBs
NCBI-GeneID: 7846543
NCBI-ProteinID: XP_001016067
TGD: TTHERM_00878160
UniProt: Q23H25
AA seq 624 aa AA seqDB search
MSTSLKGITILEENQYTREVLTPECLQFVATLHRQFNSTRKALLRARKERAQLVDRGMAL
TYPPETKHIREGDWKVAPPPKDVERRWIELTGPPNPKLTINAMNSGADVFMADFEDALAP
TWVNQVSGQKTLILANKKALQFNDKNKEYKLNPDSYTVLFVRPRGWHLEETHLVIDGEPC
SASLFDFAVYFFHNVRLRLANGCGGIYYYLPKIEAYRECRLWNDVFVKAQQLFNLPIGTI
RCTVLIETLGGGLEMEEFLYELRDHIVGLNAGRWDYIFSAIKMLKNNKAAILPDRSQVTM
TVPFMRAYTNRLIQVCHKRGAHAIGGMSAFIPAKDKAQNEFAFNKITEDKTREVNDGFDG
SWVAHPGMVKHARDIFEKYLKGKANQKQVLREDIKVTADDITNLTVEKPITENGVRQNIN
VAIQYTYYWITGTGAVGLHNLMEDAATAEISRSQLWQWIRYRCRTDSGVLINEALYRQIS
ISFNKKRLIYNYFEIKFVELQEMKKQLNQDQLQPTKWLYKELLMLLTKQSLMKLSTISQQ
LKHIQFQITQMSLMLLLDFEKKINQLSQYFKTQMTFYKYKIFLQQISFILHTYLNNLSTY
LHNSILLLKYDQFQIFFSQILFIK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactagcttgaagggtatcaccatcttagaagaaaactaatacactcgtgaggtt
ttgactcctgaatgtttacaattcgttgccaccttacatagacaattcaactctactaga
aaggccctcctcagagccaggaaagaaagagcttaactcgtcgatagaggtatggccctc
acctatcctcctgaaactaagcacattcgtgaaggagactggaaggttgctcctcctccc
aaggatgttgagagaagatggatcgaacttactggcccacccaatcctaagctcaccatc
aacgctatgaactcaggagctgacgttttcatggctgatttcgaagatgcacttgctcct
acatgggtaaattaagtcagtggacaaaagactcttatcttagccaataagaaagctctt
tagttcaatgacaaaaataaggaatacaagttaaatcctgattcttacactgttcttttt
gttagacctagaggctggcatttggaagaaactcacttagtcatcgacggagaaccatgc
tctgcatcattattcgactttgcagtttatttcttccacaatgttagacttagacttgct
aatggttgtggtggaatctattactaccttcctaagattgaagcctacagagaatgcaga
ctttggaatgatgtcttcgttaaggcctaataactattcaacttacctattggcacaatt
agatgcacagtcttgatcgaaactttgggtggtggtcttgaaatggaagaattcctttat
gaattaagagatcacattgttggattaaatgctggtagatgggactacatcttctctgct
attaagatgcttaagaacaacaaagctgctatcctccctgacagatcccaagtcactatg
accgttcctttcatgagagcatacacaaacagactcattcaagtatgccacaagagagga
gctcatgctattggtggtatgagtgctttcattcctgctaaggataaagcttagaatgaa
ttcgcttttaacaagatcactgaagacaagactagagaagttaacgacggttttgatgga
tcttgggttgcccatccaggaatggttaagcacgctagagatatattcgaaaaatattta
aaaggaaaggctaaccaaaagtaggtattacgtgaagatattaaagtaactgcagatgat
atcaccaatttaactgttgaaaaacctattactgaaaatggtgttagataaaatatcaac
gtagctatttaatacacttattactggattactggtactggagcagttggtctccataat
ttgatggaagatgctgctactgctgaaatttcccgttcctaactctggtagtggattaga
tatagatgcagaactgactctggagtcttaataaatgaagccctttacaggtaaatatca
atttctttcaataaaaaaagattaatttataattattttgaaattaaatttgtagagctg
taagagatgaagaagtaactaaattaagatcaactttaaccaacgaagtggctttacaaa
gagctgttgatgttattgacaaagtagtccttgatgaaactttctacgatttcttaacag
ttgaagcatatccaattttaaataacttaaatgtctctcatgttactcctagactttgag
aagaaaataaactaactatcccaatattttaaaacttaaatgactttttataaatataaa
atatttttataataaatttcttttattttgcatacatatttgaataatctatctacctat
ctgcataacagtattttacttttaaaatatgatcaattctaaatattttttagttaaatt
ttatttataaaatga

DBGET integrated database retrieval system