KEGG   Tetrahymena thermophila: TTHERM_00997520Help
Entry
TTHERM_00997520   CDS       T01020                                 

Definition
(RefSeq) biopterin-dependent aromatic amino acid hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
tet  Tetrahymena thermophila
Pathway
tet00360  Phenylalanine metabolism
tet00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tet00790  Folate biosynthesis
tet01100  Metabolic pathways
tet01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    TTHERM_00997520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTHERM_00997520
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TTHERM_00997520
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     TTHERM_00997520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H DUF3693
Motif
Other DBs
NCBI-GeneID: 7829809
NCBI-ProteinID: XP_001019192
TGD: TTHERM_00997520
UniProt: Q23R09
AA seq 442 aa AA seqDB search
MFVKKALQSLLNNAVRFQNKQQMRMSQQQVFRKHFENDRVEELFIITKDYVGSLSNVLEV
FKSHRINLTFIEPKLLNKKGNNQNVMFICTFEGKRENKNVQEAFKDLQSRFDNVKFSDDV
SVVPWYPRDSSDLEHIGEELMNVVEENSADFLQFTDPEYRKRRDYIAQVSKSHILGQPIP
ILEYTDQEQQTWRSIYNKLSVYHKDVCTDKYLYHKSKLEKELGVDKKIPQLRDLDDYLRS
KTNFRIKAAHGILTQREFLNALAHRVFFSTQYIRHHKVPEYTPEPDIVHEVVGHIPMFAD
PVVADISQEIGLLSMGANDEQLRRLGNLYWFTIEFGACKENGKMKGYGAGIASSIGECEH
FLSKDSRFEYLDPFKDCDREYPIQKVQPVYLYTNSFEECLERLIKFGDQIKKPMKTWYDF
NTQTIECDRRIIATEKQQETKK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaaaaaagctcttcaaagtctcctcaacaatgctgttagattccagaataaa
cagcaaatgaggatgagccagcaataagtcttcagaaagcattttgaaaatgacagagtt
gaagaattattcatcatcactaaagactatgttggaagtttaagcaatgtccttgaagtc
ttcaagtcccatagaataaatttgactttcatagaacctaagcttctaaataaaaaggga
aataactaaaatgtcatgtttatatgcacctttgaaggaaagagagaaaataaaaacgta
taagaagcatttaaagatttacaatctagattcgataatgttaaattctccgatgatgtt
agcgtagttccatggtatccaagagatagctctgatcttgaacacattggtgaagaattg
atgaatgtagtagaagaaaactctgcagacttcttataattcacagatcctgaatacaga
aaaagaagagactacattgctcaggtttcaaaaagccatatcttaggttaacccattccc
attttagaatatacagattaggaatagtaaacatggagaagtatttataacaaattaagt
gtatatcataaagatgtgtgcactgataaatacttataccacaaatcaaagttagaaaag
gaattaggagttgataaaaaaatcccataattaagagatttagatgattatcttagatct
aaaactaacttcagaatcaaagctgctcatggtattcttacttaaagagaatttttaaat
gctttggctcatcgtgtattcttctccacttagtatattcgtcatcataaggttccagag
tacactcctgaacccgatattgttcacgaagttgttggacacattcctatgtttgctgat
cctgttgtagcagacataagttaagaaattggtttattgagcatgggtgcaaatgatgaa
tagttaagaagacttggtaatctttattggttcactattgaattcggggcttgtaaagaa
aatggaaagatgaagggttatggagctggtattgctagttctattggtgaatgcgaacat
ttcttaagcaaggactcaagattcgagtacttggatcccttcaaagactgcgaccgtgag
tatcctatttagaaggtataacctgtttacttgtatactaactcttttgaagaatgcttg
gaaagattgattaaatttggagactaaattaaaaaacccatgaaaacttggtacgatttc
aacacacaaacaattgaatgcgatagaagaatcattgctactgaaaagtaacaagaaact
aaaaaatga

DBGET integrated database retrieval system