KEGG   Tetrahymena thermophila: TTHERM_01084290Help
Entry
TTHERM_01084290   CDS       T01020                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
tet  Tetrahymena thermophila
Pathway
tet00790  Folate biosynthesis
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TTHERM_01084290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tet04147]
    TTHERM_01084290
Enzymes [BR:tet01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     TTHERM_01084290
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTHERM_01084290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 7830859
NCBI-ProteinID: XP_001030425
TGD: TTHERM_01084290
UniProt: Q22BT8
AA seq 250 aa AA seqDB search
MILISYQQSYYFLIHQLSTQIRQFFFLIQNIQIKQKILLFFVRTQTRKNSLAFQYKKIKQ
YALSYQKQIFYQVYNFYLQKKYQLNLLDYKQKKSPIFRMLNNIRKQLFSSSSLLPKFNSF
KEVHNLPYKKLSVAQMQELLNKVNAGDWKIQGEGQKIRKELKFKDFIQAFSFMNSVAIVA
EDMCHHPDWFNVYNNVQINLNTHDVSGLSIRDVILAFAINEIQHQANKPQGLNDVSYLNQ
QAILSKWNSL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgatattaatttcttattaataaagttattactttttaattcattaattatcaacttaa
attagacaatttttttttttaatttaaaatatttaaataaaataaaaaattttattattt
tttgttagaacttaaacaagaaagaattcacttgcattctaatataaaaaaattaaataa
tacgcattatcttatcaaaaatagatattttattaagtttataatttttatctttaaaaa
aaatatcaattgaatcttttagattacaaatagaaaaaatcacccatttttagaatgctt
aataacattagaaagcaattattttcaagttcaagcttacttcctaaatttaattccttt
aaggaagttcataatttgccctacaaaaagctttcagtagcttaaatgtaagaattactt
aacaaagttaatgctggagattggaaaatttaaggtgaaggctaaaaaataagaaaggaa
ttaaaatttaaggatttcattcaagcattttccttcatgaacagtgttgctatagttgct
gaagatatgtgccatcatcctgactggtttaatgtttataacaatgtacaaattaatcta
aatactcacgatgtctctggactctctattagagatgttattttagcattcgcaattaat
gagatttaacaccaagctaataagccttaaggactcaatgatgtttcatacttaaactaa
taagctattttatctaagtggaattctctttga

DBGET integrated database retrieval system