KEGG   Tetrahymena thermophila: TTHERM_01250150Help
Entry
TTHERM_01250150   CDS       T01020                                 

Definition
(RefSeq) lysozyme protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5502
Motif
Other DBs
NCBI-GeneID: 7836380
NCBI-ProteinID: XP_001021820
TGD: TTHERM_01250150
UniProt: Q23YF8
AA seq 240 aa AA seqDB search
MNKIILLTLVVLSLLLATEARFEEPFFGFTQNQPLEEEEFQCLRDTTYYFIQTITGNDPQ
TVYQARMASFSGLDTQLIYIPCINKDTDSYPESRVTDQVKTFLKTVHQVSCQVIWIQISV
NDDEKCKWTDDIDFNCQRTKEIANYLKATANKNIGFFSSQEDWIKIFGSSEGCSSVSDKK
NFYPLYYKHLDGQPNTHDYKDHKFGSFENPAMKMYLSTEECNIKFNANVYYPQYLHIYDY
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaataatcttactaactttggtagtcctttctctattgttggcgactgaagcc
agattcgaagaacctttctttggattcactcaaaattaaccacttgaagaagaagaattt
taatgcttaagagatactacttattattttatccaaactattactggtaatgatcctcaa
actgtttactaagctagaatggctagtttttctggcttagacactcaacttatctacatc
ccatgcattaataaagatactgatagctatccagaaagcagagttactgattaagtaaag
acattcttgaaaaccgttcattaagtctcatgctaagttatttggatttaaatttcagtt
aatgatgacgaaaaatgtaaatggactgatgatatcgatttcaattgctaaagaactaaa
gagattgctaactatttaaaagctactgctaataagaatattggtttcttttcttcctaa
gaagactggattaaaatttttggaagtagcgaaggttgttcttcagtatcagataaaaaa
aatttctaccctctctactataagcatttagacggttaacctaatactcacgattacaaa
gatcacaaatttggaagttttgaaaatccagccatgaaaatgtatttatcaactgaagaa
tgcaatattaaattcaatgctaatgtttactatccataatatttacatatatatgactac
tga

DBGET integrated database retrieval system