KEGG   Tetrahymena thermophila: TTHERM_01443850Help
Entry
TTHERM_01443850   CDS       T01020                                 

Definition
(RefSeq) Serine/Threonine kinase domain protein
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
tet  Tetrahymena thermophila
Brite
KEGG Orthology (KO) [BR:tet00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tet01001]
    TTHERM_01443850
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tet03036]
    TTHERM_01443850
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     TTHERM_01443850
Protein kinases [BR:tet01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   TTHERM_01443850
Chromosome and associated proteins [BR:tet03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     TTHERM_01443850
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    TTHERM_01443850
  Sister chromatid separation proteins
   Polo kinases
    TTHERM_01443850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 7824437
NCBI-ProteinID: XP_001029550
TGD: TTHERM_01443850
UniProt: Q229B8
AA seq 686 aa AA seqDB search
MSQQAAQQQPQQKQSEQGQNNNNDQGVANYPTEQKIIEEKTENKVTGEKIIKKYSRGKLL
GSGGFAKCYEVIALDTDPKAIFAAKIIPKSTLTKSRQRVKLISEIKIHKSLHHKNIVQFE
HVFEDHDNVYILLELCPYQTLNELIKRRKRITEYETQIYVMQIVNALKYLHQNKIIHRDL
KLGNLFLGDNMTLKIGDFGLATKIEYEGEKKKTVCGTPNYIAPEILEGKDGHSYEVDMWS
LGVIIYTLLIGKPPFETKDVRTTYKRIKMNNYCFPEQIQISDNAKSIITSILNLNPQKRL
TLDELLEHPFMQGTALNPENLPISSLVVPFQKPKKEALKEKSNNQIVQDQKIGSGSLAST
QSQMNMAATQSGLQLNGTKDLNGNMRSQSNKNLGSNQMDQANLLKMQSMQTLKHGQFNSD
LNSENILVNTPPASEIWVTQWVDYSNKYGLGYALNNGTIGVFFNDFTKIVIDPEGQYIEY
YEKQPEEKYQKSITFTPDNYPQELKKKVTLLEHFRSYLQGDHGSNNQNANNNYDVNPPST
FLDNQTGKKMLYYVKKWVKTKNAILFRLQNKIVQVSFSDKTEIILNSIMKIVTFNNKQGI
RQNYPLTPDLKMYSPEMEKRLKYTKQILTDILKQSQPSQNNINNNPQNNTQRQPMQPSSL
SNQNNQNINTNGELLNNSQKQNFVLK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaataagctgcttagtagtaaccccagcaaaaataatccgagtaaggttagaat
aataacaatgatcaaggtgtagccaactaccctactgaataaaagataatagaagaaaag
acggaaaataaagtaacaggtgaaaagattattaaaaagtattctagaggaaagttatta
ggtagtggaggttttgcaaaatgttatgaagtgattgctttagacacagatccgaaggca
atatttgctgccaagataattccaaagtcaactttaactaaaagcagataaagagtgaaa
ttgatttcagaaattaaaattcataagagcttgcatcataagaatattgtttagtttgag
catgtttttgaggatcatgataatgtttacattcttcttgaattgtgtccttattaaact
cttaatgagctaatcaagcgtagaaagcgtattacagaatacgaaacataaatttacgta
atgcaaatagtgaatgccctgaaatatctccattaaaataaaattatccaccgtgatctt
aaattgggcaatctatttttaggtgacaacatgacacttaaaattggtgattttggttta
gctactaaaatagaatatgaaggagagaaaaagaaaacagtatgcggtactcctaactat
atagcaccagaaatacttgaaggaaaagatgggcattcctatgaagttgatatgtggtca
ttgggagtcatcatttatactttgcttattggaaagcctccatttgaaactaaggacgtc
agaactacatataaaagaatcaaaatgaacaattattgtttcccagaatagatttaaata
tctgacaatgctaagtctatcatcactagcattttaaatttgaatccttaaaaacgtcta
acattagatgaattattagagcaccctttcatgcaaggaacagctttgaatcctgaaaat
ttacctatttcttctttagtggtgccattttagaagcctaaaaaggaagcattaaaagaa
aagagtaataactaaatagtacaagattaaaagataggttcaggaagcttagcttctact
taaagctaaatgaatatggcagcaacttaatctgggttataactaaacggaacaaaggat
ttaaatggaaatatgaggtcttaaagcaataaaaatttaggtagcaactaaatggatcaa
gcaaatttgttaaaaatgtagtctatgcaaactttaaagcacggatagtttaacagcgat
ttaaattcagaaaatattttggtaaatactcctccagcttcagaaatatgggttactcaa
tgggtagattattcaaataaatacgggttaggatatgcactgaataatggaactattggt
gtattctttaatgattttactaaaattgtaatcgatccagaaggtcagtatattgaatat
tacgaaaaatagcctgaagagaaataccaaaaaagcataaccttcacacctgataattat
ccctaagaactcaagaaaaaagttacccttttagagcattttagaagctatttacaaggc
gatcatggatctaacaattaaaatgctaataataactacgatgttaatcctccaagcaca
ttcttagataattaaactggtaaaaaaatgttgtattatgtcaagaagtgggtaaaaaca
aaaaatgctattttgtttcgcttgcaaaataagattgtacaagtcagcttctcagataag
actgaaattattttaaacagcatcatgaaaatagtcacatttaacaacaagtaaggcatt
agataaaactatcccttaactcctgatctaaaaatgtactcacctgaaatggaaaagagg
ttaaagtacacgaagcaaattctcacagatatccttaaataaagctaacctagttaaaac
aatattaataacaacccttaaaacaacacataaaggcaaccaatgcagccttcttcatta
tcgaattaaaataattaaaatataaatacaaatggtgaattattaaacaattcttaaaag
taaaactttgtcctaaaatga

DBGET integrated database retrieval system