KEGG   Thermococcus eurythermalis: TEU_01905Help
Entry
TEU_01905         CDS       T03421                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
teu  Thermococcus eurythermalis
Brite
KEGG Orthology (KO) [BR:teu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TEU_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: AIU69190
UniProt: A0A097QRT8
Position
complement(343540..344751)
Genome map
AA seq 403 aa AA seqDB search
MDPWLLITIALGFAMAWAIGANDAANSMSTAVGAKAITPKQAVVIAGVLEFAGAYFFGKS
VTETVRKGILDPSMITDPNVLIYGSVAALLAATIWLIIATKFGLPVSTTHSIIGGIAGYG
IVYAGTEIVNWGKMGQVVLSWILSPIVGAVMAYLIFKMFTKSIFETRDPVRSARIWSPFW
IGMAFVVIGTMFYLKVLHGNDLKTGVLLYGIPLGVVVFAMTYLLIRLRFPSSDPFIGVEA
IFRKAQVITSAYVALAHGANDVANAIGPVAAVYAVATMGLAGMKVPVPRWILALGGLGIA
VGVATYGYRVMETVGKKITELTNTRGFTIDFSAATVVLIASWLGMPISTTHTVVGAVIGI
GLARGVKAINKDIVRDIIISWFVTVPVAGLISAAIFKLLMIVG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggacccttggttgctgataacgattgcccttggattcgcgatggcctgggcgataggt
gcgaacgacgccgctaactcgatgagcacggccgtgggtgcaaaggctataaccccgaag
caggctgttgtgatagccggcgtccttgagttcgctggcgcctatttctttggaaagagc
gttaccgagacggttaggaagggcatcctcgacccgtctatgataactgacccgaacgtc
ctcatatatggctccgtggcagcgctcctggccgcgaccatctggctcatcatagccacc
aagtttggcctgcccgtctcgacaacacactccatcataggcggaatagcaggctatgga
atagtttacgccggtactgagatagtcaactggggcaaaatgggccaggtcgtcctcagc
tggattctctcgcccatagtcggtgccgtaatggcatatttaatattcaagatgttcacg
aagagcatcttcgagacgagagaccccgttaggagtgctcggatatggtcgcctttctgg
attggtatggcgtttgtcgtgatcggaactatgttctatcttaaggttctccatggaaac
gacctcaagaccggagttctgctgtatggcattcctctgggagtagtcgtgtttgcaatg
acctaccttctgataaggctccgcttcccgagcagtgacccgttcattggcgtcgaggca
atattcaggaaagcacaggtgattacctccgcctacgttgccctcgcgcacggtgccaac
gacgtcgcaaacgccatcggccctgttgcggccgtttacgccgttgccacgatggggctg
gccggaatgaaggtgcccgtgccgaggtggattttggccctcggtggtctcggcatagcg
gtcggcgtcgccacatacggctaccgcgtcatggagaccgttggcaagaagataacagaa
ctgacgaacacccgcggcttcactatagatttttcagcggcaaccgtcgtcctcatcgcg
agctggctcggaatgccgatttcgacgacgcacaccgtcgttggagctgtcataggaata
ggccttgcgaggggagtaaaggcaataaataaagacatcgttagggacataataatttcc
tggttcgttaccgtcccggtcgctgggctgataagcgcggccattttcaaactcctgatg
atcgtggggtga

DBGET integrated database retrieval system