KEGG   Thermococcus eurythermalis: TEU_03720Help
Entry
TEU_03720         CDS       T03421                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
teu  Thermococcus eurythermalis
Pathway
teu00627  Aminobenzoate degradation
teu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:teu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TEU_03720
Enzymes [BR:teu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     TEU_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 PGP_phosphatase Phage_GP20 DUF1962
Motif
Other DBs
NCBI-ProteinID: AIU69527
UniProt: A0A097QST9
Position
complement(704114..704914)
Genome map
AA seq 266 aa AA seqDB search
MIGIIFDMDGVVYRGNQRIEGAKEAIEYLKEKGIPFVFLTNNSTRTPKMYREKLLSMGID
VPEERIVTSGLATRLYMKEHMEPGKVFVIGGKGLHEEMENLGWGTVSLEECREGKWKEIR
HVVVGLDPELTYEKLKYGTLAIRNGATFIGTNPDTTYPAEGGLYPGAGAIIASLKASTDR
EPLIIGKPNEPACEVVKTKLGNVDEIWMVGDRLDTDIAFAKRFGMKALMVLTGVSTLNDV
EKSEVKPDLVLPSIKGLLDYLKAVVE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgattggaataatattcgatatggacggtgtcgtttacaggggtaaccagcgcatcgag
ggggcaaaggaggcaatcgagtacctcaaggagaagggaatcccctttgtcttcctcacc
aacaactccaccagaacacccaaaatgtatcgagaaaagctcctctccatgggcatagac
gtcccagaggagagaatagtcacctccgggctggcgacgaggctctacatgaaggaacac
atggagcccgggaaggtctttgtcataggcggcaaggggctccacgaggagatggaaaac
ctcggctgggggacggtgagccttgaagagtgcagggaaggaaagtggaaggaaatcagg
cacgtagtcgtcggcctcgacccggagctgacctacgagaagctcaagtacgggacgctc
gccatcaggaacggggcgacatttatagggacgaaccccgacaccacttacccggcagag
gggggcctctaccccggcgccggggcaataatagcgtcgctgaaggcatcaactgacagg
gaacccctcataatcggaaagccgaacgagccggcctgtgaggttgtaaaaacaaagctc
ggcaacgttgacgaaatctggatggtcggcgacaggcttgacacggacatagcatttgca
aagcgcttcggcatgaaggcattgatggttctcacgggcgtcagcaccctgaatgacgtc
gagaagagtgaagtcaagcccgacctcgtcctgccgagcataaaggggctcctcgactac
ctcaaagcggtggtagaatga

DBGET integrated database retrieval system