KEGG   Thermoanaerobacter sp. X514: Teth514_1233
Entry
Teth514_1233      CDS       T00648                                 
Name
(GenBank) hypothetical protein
Organism
tex  Thermoanaerobacter sp. X514
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: ABY92527
UniProt: B0K6Q1
Position
1274516..1275076
AA seq 186 aa
MSKTAKRTNPTKVVTGVVRLSYANVWEPKSINGGAEKYSVSLIIHKSDTKTLSAINEAVN
AAIEEGKGKFGGKIPNKAALKLPLRDGDIDRPDDEAYANSYFINANSNTPPQIVDRNVNP
IIDRSEVYSGVYARVSINFYAFNSNGNKGIACGLGNIQKIRDGEPLGGRTNAADDFVTDV
DDDFLS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtcaaaaacagcaaaaagaacaaatccaacaaaagtagttacaggagttgtcagactt
tcttatgctaatgtgtgggaacctaaatcaatcaatggcggtgctgaaaaatacagtgtg
agcctgattattcataagagtgatactaaaaccttaagtgctatcaatgaagcggtgaat
gctgcaatagaagaaggtaaaggtaaattcggtggtaagattccaaataaagcggcgtta
aagcttcctctacgtgacggagatattgatcgtccagatgatgaagcttatgcaaatagc
tattttatcaatgccaatagcaatacccctccacaaattgtagatagaaacgtcaatcca
atcattgatcgttctgaagtatactctggtgtctatgcaagagtgagtatcaacttctac
gcctttaactccaatggaaacaaaggtatagcctgtggacttggaaatattcaaaaaatc
cgtgatggtgaacctttgggtggcagaactaatgcagctgatgattttgtcactgatgtg
gatgatgactttttatcatga

DBGET integrated database retrieval system