KEGG   Thermoanaerobacter sp. X514: Teth514_0552Help
Entry
Teth514_0552      CDS       T00648                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:tex00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Teth514_0552
Enzymes [BR:tex01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Teth514_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABY91860
UniProt: B0K3T5
Position
573262..573858
Genome map
AA seq 198 aa AA seqDB search
MKIIIATHNPHKTEEIKNFFKGYPVEIYSMADLGIKEDIEETGDTIEENALIKARFLKEK
VDGIVIADDTGLFVEHLNGQPGVYSARFAGENATYEDNNKKLLKLLEGVPYEKRKAYFKT
VIAVVEREKETLLEGKLEGHILDHPRGKNGFGYDPVFYVDNLGKSLAELTMEEKNKISHR
ADALMKLKNYILKRLEEK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataataatagcaacccacaatcctcacaaaactgaagaaataaaaaattttttt
aaaggctatcctgttgaaatttattctatggcagacttgggtataaaagaagacatagaa
gagacaggagatacgattgaagaaaatgctcttatcaaggctcgttttttaaaagaaaaa
gttgatggaattgttatagctgacgatacaggattgtttgtggagcatttaaatggacaa
cctggagtatattcagcaagatttgctggtgaaaatgctacctatgaagataacaacaaa
aaattattaaaactattagagggtgttccttacgaaaaaagaaaagcttattttaagaca
gtaatagcagtggtagaaagggaaaaagaaactttattagaaggtaaattagaagggcac
attttagatcatcctcgagggaaaaatggttttggatatgacccagttttttatgtcgat
aatttaggaaagagtttggcagaacttactatggaagaaaaaaataagataagtcataga
gctgatgctcttatgaagttaaaaaattatattttaaaacgtctggaggaaaaataa

DBGET integrated database retrieval system