KEGG   Thermoanaerobacter sp. X514: Teth514_0627Help
Entry
Teth514_0627      CDS       T00648                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00010  Glycolysis / Gluconeogenesis
tex00071  Fatty acid degradation
tex00350  Tyrosine metabolism
tex00620  Pyruvate metabolism
tex00625  Chloroalkane and chloroalkene degradation
tex00626  Naphthalene degradation
tex00650  Butanoate metabolism
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01120  Microbial metabolism in diverse environments
tex01130  Biosynthesis of antibiotics
tex01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_0627
   00620 Pyruvate metabolism
    Teth514_0627
   00650 Butanoate metabolism
    Teth514_0627
  Lipid metabolism
   00071 Fatty acid degradation
    Teth514_0627
  Amino acid metabolism
   00350 Tyrosine metabolism
    Teth514_0627
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Teth514_0627
   00626 Naphthalene degradation
    Teth514_0627
Enzymes [BR:tex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Teth514_0627
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Teth514_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 GidB DUF2703
Motif
Other DBs
NCBI-ProteinID: ABY91935
UniProt: B0K4A2
Position
complement(652326..654944)
Genome map
AA seq 872 aa AA seqDB search
MPTLLQEKKETKEKTEVKETTDVKKQIDLLVERAKRAQEKFMSYTQEQINEIVKAMALAG
IEKHVELAKLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTVGILKENLEENYMEVAE
PVGVIAGVTPVTNPTSTTMFKCLIAIKTRNPIIFSFHPKALKCSIEAAKTMYEAALKAGA
PEGCIGWIETPSIEATQLLMTHPDISLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIE
KTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIADEVKKLMREYGCYFLNKEETKKL
EEFAIDKNTGLMNPAVVGQPATKIAEMAGFKVPENTKILVAEYPAVGPEYPLSREKLSPI
LALYTVKDYNEGIKRCEEMTEFGGLGHSAVIHSENQQIINEFAKRVRAGRILVNAPASQG
AIGDIYNTAIPSLTLGCGTMGRNSTTDNVSVYNLINIKRVFIRKERMKWFRVPPQIYFER
GSLQYLSQVKGKKAFIVTDPVMVKLGFVDKVTYQLDKANIKYEIFSEVEPDPSVDTVEKG
VKIMRGFEPDLLIAVGGGSAIDAAKGMWLFYEYPDTKFEDLRLKFMDIRKRTYRFPELGK
KALFIAIPTTSGTGSEVTAFAVITDKKKNIKYPLTDYELTPDIAIIDPDLTMTIPPSVTA
DTGMDALTHAIEAYVSVMASDYTDALAEKAIKLIFEYLPKAYKNGQDKVAREKMHNASCI
AGMAFTNAFLGINHSMAHILGAKFHLPHGRANAILLPYVIEYNAELPKKFASFPQYEYPK
AAEKYAEIAKFLGLPASTIEEGVKSLIEAIKNLMKELNLPLTLKEAGINKEEFEKQIMEM
SDIAFNDQCTGSNPRMPLVSEIAEIYRKAYGE
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccttattacaagaaaaaaaggaaacaaaagaaaaaacagaagtaaaagaaaca
acagatgttaaaaagcagatagacctattagtagaaagagcgaaaagagcacaagaaaaa
ttcatgtcatacacccaagagcaaattaatgaaatagtcaaagccatggcactagcaggc
atagaaaagcatgtagaactggcaaaattagctcatgaagagacgaaaatgggggtttat
gaagacaaaataaccaaaaacctttttgcagtagaatatgtgtacaattatataaaagac
aaaaaaactgtcggcatcctcaaagaaaacttagaagaaaattatatggaagtggcagaa
cctgtaggagttatagccggcgtaacacctgtcacaaacccgacttctacaacaatgttc
aaatgcctcattgctatcaaaacaagaaatccaataattttcagcttccacccaaaagca
ttaaaatgtagtatagaagcagcaaagacgatgtacgaggcagcattaaaggctggtgca
ccagaaggatgtataggatggattgagacaccctcaattgaagcaacacaacttctcatg
acacatcccgatatatctcttatcctagcaacaggcggcgccggaatggtaaaagctgct
tacagctcaggaaaacccgcccttggcgtaggtcctggcaatgtcccctgctatattgaa
aaaactgcaaatattaaaagagcagtttcagatttaatacttagtaaaacttttgacaat
ggtacagtatgtgcctcagagcaagctgtaataatagatgaagaaatagccgatgaagta
aaaaaattaatgagagaatatggttgctatttcttaaataaagaagaaactaaaaagtta
gaagaattcgctatagacaaaaacaccggtttaatgaatccagcagttgtaggtcaaccg
gcaacaaaaattgctgaaatggctggatttaaagtacctgaaaacacaaaaatacttgta
gctgaatatcctgctgtaggaccagaatatcctctctccagagaaaagctaagtccaata
cttgctttatacacagtcaaagattacaacgaaggcataaaaagatgtgaagaaatgaca
gaattcggcggacttggtcactctgcagtaatacattctgaaaaccaacaaattattaat
gaatttgcaaaaagagtacgagcaggaagaattcttgtaaacgcccctgcttctcaagga
gctattggagatatttataacacggctatcccatctttgactttgggttgcggtacaatg
ggtagaaattcaacaacagataatgtaagtgtttataaccttataaacataaaacgagtt
tttataagaaaagagagaatgaaatggttcagagttccaccacaaatttattttgaaaga
gggtcattacaatatctgtcacaagtaaaaggcaaaaaagcctttattgtaacagaccct
gtgatggttaaattaggttttgtagataaagtaacgtatcaattagataaggcaaatatt
aaatatgaaatattctctgaagttgaaccagatccttcagttgacactgtagaaaaaggg
gtaaaaataatgagagggtttgagcctgacttactaatagctgtaggtggtggttctgca
atagatgcagcgaagggaatgtggcttttctacgaataccctgatacaaaattcgaagac
ttaaggttaaaatttatggacataagaaaaagaacttatagatttcctgaactggggaaa
aaagctttatttatcgcaataccaaccaccagcggtacaggttctgaagttactgccttt
gcagttataacagacaaaaagaaaaatataaagtaccctctcacagattacgaattaaca
ccagatatcgctataatagaccctgacctcacaatgacaataccaccctctgtcacagca
gacactggtatggacgctttaacccatgctattgaagcctatgtatctgtaatggcatca
gactatacagacgctctcgcagaaaaagctataaaattgatatttgaatatctacctaaa
gcatacaaaaacgggcaagataaagtcgcccgcgaaaagatgcacaatgcttcatgcata
gctggaatggccttcacaaatgcatttttaggaataaaccatagtatggctcatatactt
ggtgctaaattccatcttccacacggaagagcaaatgcaatacttctgccctatgtcata
gaatacaatgctgagttacctaaaaaatttgcttcattcccacaatatgaatatcccaaa
gcagccgagaaatatgcagaaattgcaaaattcttgggacttcctgcatcaaccattgaa
gaaggagtaaaaagcctcattgaagcaataaaaaatcttatgaaagagcttaatcttcct
ttgacacttaaagaagcaggcataaataaagaagaattcgaaaaacaaataatggaaatg
tctgatatagcctttaatgaccagtgcaccggttcaaacccaagaatgccattggtatcc
gaaattgcagaaatatatagaaaagcctatggagaataa

DBGET integrated database retrieval system