KEGG   Thermoanaerobacter sp. X514: Teth514_1480
Entry
Teth514_1480      CDS       T00648                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00472  D-Arginine and D-ornithine metabolism
tex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Teth514_1480
Enzymes [BR:tex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Teth514_1480
SSDB
Motif
Pfam: OAM_alpha DUF2067 Lys-AminoMut_A RTC
Other DBs
NCBI-ProteinID: ABY92767
UniProt: B0K0P2
Position
1513109..1513483
AA seq 124 aa
MKRVDDFETRSKHLQHMTDEELDAYFWELAEKIVDPLIELAYYHTSPSIERSVLLRMGFS
SIEAKEIVNRIEERGLLPKGAGNIVLKVAERLKKDYLAAGKAIANGEYLEVLDDIAREAR
KNEA
NT seq 375 nt   +upstreamnt  +downstreamnt
gtgaaaagagtagacgattttgaaacgaggagtaaacaccttcaacacatgacagatgaa
gaattagacgcatatttctgggaattggcagaaaaaattgtagaccccttgatagagttg
gcatattatcacacatctccatctattgaacgctctgtgcttttaaggatgggtttttct
agtattgaggcaaaggagattgtaaacagaattgaggaaagagggcttttgccaaaagga
gcaggaaatattgtgttaaaagttgcagaaagactcaaaaaagattaccttgctgctgga
aaagccatagctaacggagagtacttggaggtgcttgatgatatagcaagggaggctagg
aaaaatgaagcttga

DBGET integrated database retrieval system