KEGG   Thermoanaerobacter sp. X514: Teth514_1582Help
Entry
Teth514_1582      CDS       T00648                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00620  Pyruvate metabolism
tex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Teth514_1582
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tex02000]
    Teth514_1582
Enzymes [BR:tex01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Teth514_1582
Transporters [BR:tex02000]
 Other transporters
  Primary active transporters [TC:3]
   Teth514_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: ABY92869
UniProt: B0K174
Position
1601485..1602882
Genome map
AA seq 465 aa AA seqDB search
MSNKIKITETVLRDAHQSLLATRMSTEEMLPIAEKLDAVGYYSIEAWGGATFDACMRFLD
EDPWERLRRLKKRIKNTPLQMLLRGQNLLGYRHYPDDIVEKFVERAVANGIDIIRIFDAL
NDVRNLEVAVKATKKAGAHAQGTLVYTISPVHNIDHYIKVAKELTELGVDSICIKDMSGI
LTPYVAYELVKSLKDAVNIPIQLHSHYTSGMAAMTYLKAIEAGVDIIDTAISPLALGTSQ
PATETMVAILKGTQYDTGLDMELLSEIASYFKEVKQNHSKEIDLSMVMGVDTDVLIYQVP
GGMLSNLISQLKQQNVLDKYPEVLKEIPKVREELGYPPLVTPMSQMVGTQAVLNVITGER
YKMVPKEVKDYVKGLYGRPPAPISEEIKKKIIGDEEVIDIRPADLLKPQFEAIKEEIKEY
YEQEEDVLSYALFPQVAKKFFEYRRAKKYQIDATLLNMEYMTYPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaattaaaattacagaaactgtattaagagatgcccatcagtcactcttg
gctactcgaatgtcgacggaagaaatgctcccaattgcagaaaaattggatgcagtagga
tattattctattgaagcgtggggaggagctacctttgatgcttgtatgagatttcttgac
gaagacccttgggaaagattgagaagattaaagaagaggataaaaaatacccctcttcaa
atgcttttgagaggacaaaatctattaggatataggcattatcctgatgatatagtagaa
aaatttgttgagagggctgttgctaacggaatagatataataagaatttttgatgcttta
aatgatgtacgaaatcttgaagttgccgttaaagctactaaaaaagcgggagcccacgct
caaggtacccttgtttatactataagtcctgttcacaacattgaccattatattaaagta
gcaaaagagctgacagaattaggagtggattccatatgcataaaggatatgtcaggaata
ttaactccttatgttgcttatgagttagtaaaaagccttaaagatgcagtaaatattcct
atacagttgcacagccattatacgagtggaatggcggctatgacttatcttaaagcaata
gaggctggagtagatataatagacactgctatttcacctttggcattaggaacttctcaa
cctgctacagaaacaatggtagctattttaaaaggcactcaatatgacactggtttggat
atggagttattatcagaaattgcttcatactttaaagaagtaaaacaaaatcacagtaaa
gaaatagatttatctatggttatgggcgtagatacagatgtattaatttatcaagttcca
ggaggaatgctatcaaatttaatttcccaattaaaacaacaaaatgttttagataagtac
ccagaggttttaaaagaaattcctaaagttagagaagaattaggatacccacctcttgtt
actcctatgagtcagatggtagggactcaagctgtcttgaatgtaataactggagaaagg
tataaaatggtaccaaaagaagtaaaagattatgtgaaaggactgtatggtagaccacca
gcgccaatttcagaagaaataaagaaaaaaataataggagatgaagaggtaatagatatt
agaccagcagaccttttaaaaccgcaatttgaagcgattaaagaagaaattaaagagtat
tatgaacaagaagaagatgttttatcttatgctcttttcccacaagtagcaaagaagttt
tttgaatacagaagagcaaaaaaatatcaaatagatgcaactcttcttaatatggaatat
atgacatatccagtttaa

DBGET integrated database retrieval system