KEGG   Thermoanaerobacter sp. X514: Teth514_1759Help
Entry
Teth514_1759      CDS       T00648                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00770  Pantothenate and CoA biosynthesis
tex01100  Metabolic pathways
Module
tex_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Teth514_1759
Enzymes [BR:tex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Teth514_1759
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Teth514_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Shikimate_DH PspC adh_short
Motif
Other DBs
NCBI-ProteinID: ABY93045
UniProt: B0K294
Position
complement(1764150..1765349)
Genome map
AA seq 399 aa AA seqDB search
MNTSKKNVVLGVTGGIAAYKAADLTSRLVKKDINVDVIMTKEATNFINPLTFEALTNNKV
VVDMFEDRKYWEIEHISLAKKADVFAIVPATANIIAKIAHGIADDMLTTTILATKSPVLI
APAMNTNMYTNPVTQKNIKILKEYGFLFVEPAAGRLACGTYGAGRLADVEEIEKAILELL
DNEKKRDFEGKKVLVTAGPTREPLDPVRYITNRSSGKMGYEIAKALVERGAQVILISGPT
YIEVPKDVTFIPVETAVDMYNAVMMHLNEVDIVIGAAAVSDYRPKEMKKEKIKKDEEKLT
IELVKNPDIMYEVGQKKGNKISIGFAAETTNLVEYAQRKLKEKNMDLIVANDVTQKGAGF
EVDTNIIKIIDRDLNVKEYPLMTKIEASHVILDEIAKLL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaagcaaaaaaaatgtagtattaggggttacaggaggtatagcagcttataaa
gctgcagaccttacatctcgactcgtaaaaaaagacataaatgtggatgtcataatgaca
aaggaagctacaaattttataaatcctctcacttttgaggctttaactaacaataaagta
gttgttgatatgtttgaggataggaaatattgggaaattgagcatatttctttagcaaaa
aaagctgatgtatttgcaatagttcctgcaaccgcaaatattattgctaaaattgctcat
gggattgcagacgatatgttaactactactattcttgctacaaagagtcctgtactaatt
gctcccgccatgaatacaaacatgtataccaatcctgtgactcaaaagaatattaaaatt
ttaaaagaatatggttttttatttgtggagccagctgccggaaggcttgcttgtggaact
tatggcgcaggaagattggctgatgtagaggagattgaaaaagctattttagagttattg
gacaatgagaaaaaaagagattttgaagggaaaaaggtgttagtaacagcagggcctact
cgagagcctcttgatcctgtaagatacattacaaatcgctcttcgggtaaaatgggctat
gagattgcaaaagctttagtggaaagaggggcacaagtgattttaatttctgggcctact
tatatagaggtacctaaagatgtgacttttattcctgtagaaacagcggtagatatgtac
aatgctgtcatgatgcaccttaatgaagtagacattgtcataggggctgcagctgtttct
gactacagacctaaagagatgaaaaaagaaaagataaaaaaagatgaagagaaattaact
attgaattagttaaaaatccagacataatgtatgaagtaggacagaaaaaaggaaacaag
atttcgataggttttgctgctgaaactactaatttagtagaatatgcacaaagaaagtta
aaggagaaaaatatggatttaatagttgcaaatgatgtaactcaaaagggagcaggtttt
gaagtagacacgaatataataaaaatcatagatagagatttaaacgtaaaggagtatcct
ttgatgacaaagatagaagcttctcatgtgatattagatgaaatagctaaattgttgtaa

DBGET integrated database retrieval system