KEGG   Thermoanaerobacter sp. X514: Teth514_2310Help
Entry
Teth514_2310      CDS       T00648                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00260  Glycine, serine and threonine metabolism
tex00750  Vitamin B6 metabolism
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01120  Microbial metabolism in diverse environments
tex01230  Biosynthesis of amino acids
Module
tex_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth514_2310
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Teth514_2310
Enzymes [BR:tex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Teth514_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABY93573
UniProt: B0K542
Position
complement(2330199..2331254)
Genome map
AA seq 351 aa AA seqDB search
MGWEGLIKAYREFMPKIKEENIVTLKEGNTPLYEAVNLQKLFPGIKIYLKYEGLNPTGSF
KDRGMTVAVSQAKEEGSNAVVCASTGNTSASAAAYAAKAGLKSIVLIPGGKIALGKLAQA
IAYGAKVIAIDGNFDDALRLVREISQKFPITLVNSINPYRLEGQKTASFEICDELKDAPS
YVALPVGNAGNITAYWMGFKEYYNAKRITRLPKMLGFQAAGAAPIVENRVIEKPETIATA
IRIGNPASWEKAVAARDESGGLIDKVTDEEILEAYALLAKSEGIFAEPASAASIAGVIKK
YKEGFFKEGESVVCVLTGNGLKDPDTAVKLGGEIKTIEANLKALEEVLYGE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggatgggaaggtctaataaaagcttatagagaatttatgcctaaaataaaagaggaa
aacatagttacattaaaagaaggcaatacacctctttatgaggctgtaaatcttcaaaag
ctttttccaggcataaaaatatatctgaaatacgaaggattaaacccaacaggttctttt
aaagacagggggatgactgtagcagtgtcgcaggcaaaagaagaaggttctaatgcagtt
gtgtgtgcttcaacaggaaacacttctgcttctgcagctgcctatgcagcaaaggcagga
cttaagagcattgtacttatacccggcggcaaaattgctttaggaaagcttgctcaagcc
attgcttatggtgctaaagtcattgctatagatggaaactttgatgatgctttaagatta
gtcagagaaatttcacaaaaattccctataacgctggttaattccataaatccatatagg
ttggaaggacaaaagacagcttcttttgaaatatgtgacgaacttaaagatgctccttct
tatgttgcgcttcctgtgggaaatgcggggaatataacagcctattggatgggatttaaa
gaatattataatgcaaaaagaataacgaggcttcctaaaatgttaggttttcaggcagct
ggagctgcacctatagttgaaaacagagtaattgaaaaacctgagactattgcaacagcg
atacgaataggtaatccagccagctgggaaaaggcagttgctgcaagagatgagtcaggt
ggactcattgacaaagtcacagatgaagaaatactggaggcttatgcgcttttagctaag
agcgaaggaatttttgcagagcctgcttcagcagcttctattgcaggagttattaaaaaa
tacaaggaaggattttttaaagaaggagaatctgttgtttgtgtcttgacgggaaatgga
ttaaaagatccagatactgctgttaaattaggtggcgagataaaaacgatagaggcgaat
ctaaaagcattggaggaagttttatatggagagtga

DBGET integrated database retrieval system