KEGG   Tessaracoccus sp. T2.5-30: BKM78_03960Help
Entry
BKM78_03960       CDS       T04747                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00450  Selenocompound metabolism
tez00970  Aminoacyl-tRNA biosynthesis
tez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tez00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BKM78_03960
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKM78_03960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tez01007]
    BKM78_03960
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tez03016]
    BKM78_03960
Enzymes [BR:tez01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BKM78_03960
Amino acid related enzymes [BR:tez01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BKM78_03960
Transfer RNA biogenesis [BR:tez03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BKM78_03960
 Prokaryotic type
   Other AARSs
    BKM78_03960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AQX15174
Position
complement(833824..835608)
Genome map
AA seq 594 aa AA seqDB search
MSHVLAAVAWPYANGPRHIGHVSGFGVPSDVFARYMRMAGHDVLMVSGSDEHGTAIQVKA
DSEGLTPRETADKYHRQIVEDLQGLGLSYDLYTRTTTPNHYRVVQDIFTALYDNGYVRAE
TQMGAISPSTGRTLPDRFIEGTCPLCGYHNARGDQCDNCGNQLDPADLIDPKSKINGETP
EFVETEHFFLDLPALAPMLGQWIDSREDWRPNVLKFSHNLLAEIRPRAITRDLDWGVPVP
LEGWRDAPMKRIYVWFDAVIGYLSASVEWAKRSGDPEAWRTFWNSTAARSYYFMGKDNIV
FHSVIWPGILLGANGQGVHGGHVRESLGELQLPTEVVSSEFMTMKGSKVSSSRGASIFVG
DFLAEFGPDALRYYIAVAGPENQDTDFTWEEFVRRINFELANEWGNLVNRSVSMAHKNVG
AVPAAGELTPADQALLDESRAAFAVVGEHIAARRFKAGITEAMRIVGLANKYLSDQEPWK
LKDDPARRDTVLHVALQVVSDCNTLLTPYLPHSAQKVFELLGGEGVWAAQPQIVDVTDED
LTYPTLQGDYAAQQAVWQPRPLQVGAPLSKPTPLFTKLDEALGLTGPSWAPIAD
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgttcttgccgccgtcgcctggccctacgccaacggcccccgccacatcggt
cacgtctcgggcttcggtgtcccctccgacgtgttcgcgcgctacatgcgcatggccggt
cacgacgtgctcatggtgtccggctccgacgagcacggcaccgcgatccaggtgaaggcc
gactccgagggcctgacgccgagggagaccgccgacaagtaccaccgccagatcgtcgag
gatctccagggcctggggctgtcctacgacctgtacacccggacgacgacgccgaaccac
taccgcgtggtgcaggacatcttcaccgccctctacgacaacggctacgtccgcgccgaa
acgcagatgggcgcgatctccccgtccaccgggcgcaccctgccggaccggttcatcgag
ggcacgtgcccgctgtgcggctaccacaacgcccgcggcgaccagtgcgacaactgtggc
aaccagctcgacccggccgacctcatcgatccgaagtccaagatcaacggggagacgccc
gagttcgtcgagaccgagcacttcttcctcgacctgccggccctggcccccatgctgggc
cagtggatcgacagccgcgaggactggcggcccaacgtgctgaagttctcccacaacctg
ctcgcggagatccggccgcgcgccatcacccgcgacctcgactggggcgtccccgtcccg
ctcgaggggtggcgcgacgcccccatgaagcgcatctacgtctggttcgacgccgtcatc
ggctacctgtcggcctccgtcgagtgggcgaagcgctcgggcgacccggaggcgtggcgc
accttctggaactcgacggcggcgcgctcctactacttcatgggcaaggacaacatcgtc
ttccactccgtcatctggcccggcatcctgctcggcgccaacgggcagggggtccacggc
ggccacgtgcgggagtcgctgggcgaactgcagctgcccaccgaggtggtcagctccgag
ttcatgacgatgaagggctccaaggtgtccagctcgcggggcgcgtccatcttcgtgggg
gacttcctcgccgagttcggccccgacgccctgcgctactacatcgccgtggccggtccg
gagaaccaggacacggacttcacctgggaggagttcgtccggcggatcaacttcgagctg
gccaacgagtggggcaacctcgtcaaccggtccgtgtcgatggcccacaagaatgtgggc
gccgtgcccgcggcgggggagctgaccccggccgatcaggcgctgctggacgagagccgc
gccgcgttcgccgtcgtgggcgagcacatcgccgcgcgccggttcaaggccggcatcact
gaggcgatgcgcatcgtcggcctggccaacaagtacctgtcggatcaggagccctggaag
ctcaaggacgaccccgcccgccgcgacaccgtcctccacgtcgcgctgcaggtggtctcc
gactgcaacacgctgctcaccccctacctgcctcattcagcgcagaaggtcttcgagctc
ctgggcggcgagggcgtgtgggcggcgcagccccagatcgtcgacgtgaccgacgaggac
ctgacctacccgacgctgcagggcgactacgccgcgcagcaggccgtgtggcagccccgt
cccctccaggtgggggcaccgctcagcaagccgacgccgctgttcacgaagctcgacgag
gcgctgggcctcaccgggccgagctgggcgccgatcgccgactga

DBGET integrated database retrieval system