KEGG   Tessaracoccus sp. T2.5-30: BKM78_12145Help
Entry
BKM78_12145       CDS       T04747                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tez00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BKM78_12145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tez03011]
    BKM78_12145
Ribosome [BR:tez03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BKM78_12145
  Bacteria
    BKM78_12145
  Archaea
    BKM78_12145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4623 Corona_I Sigma70_r3
Motif
Other DBs
NCBI-ProteinID: AQX16568
Position
2633024..2633425
Genome map
AA seq 133 aa AA seqDB search
MSNENGNSRRRETLLGDRPGSYAIARHVRMSPTKVRRVVDLVRGMGVADALVALKFAPQA
ASEPVYKVVASAVANAENTEALRSDDLYISKAFVDEGVTLRRIRPRAKGSASRILKRGAH
ITVVVEPRETKGA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgagaacggcaacagccgtcgtcgcgagaccctgctcggggatcgtcctggc
tcgtacgccatcgcgcggcacgtccggatgagcccgaccaaggtccgtcgcgtcgtcgac
cttgtgcgcggaatgggcgtcgctgacgccctggtcgcgctgaagttcgcgccgcaggcc
gcttcggagccggtgtacaaggttgtggcttcggccgtggccaacgccgagaacaccgag
gccctccggtccgacgacctctacatctccaaggcgttcgtcgacgagggtgtcaccctc
cggcggatccgccctcgcgccaagggatcggccagccgcatcctcaagcgcggtgcccac
atcaccgtggtcgtcgaaccccgcgagacgaagggagcctga

DBGET integrated database retrieval system