KEGG   Tessaracoccus sp. T2.5-30: BKM78_13375Help
Entry
BKM78_13375       CDS       T04747                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
tez  Tessaracoccus sp. T2.5-30
Brite
KEGG Orthology (KO) [BR:tez00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tez03009]
    BKM78_13375
Enzymes [BR:tez01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BKM78_13375
Ribosome biogenesis [BR:tez03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BKM78_13375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 PCMT Methyltransf_31 UPF0146
Motif
Other DBs
NCBI-ProteinID: AQX16791
Position
complement(2897126..2897911)
Genome map
AA seq 261 aa AA seqDB search
MSGLDWLRCPHCAAPLTRTPGALRCAAGHSFDIARQGYVNLLGRAAPANADTPAMLEARA
RFLAAGHYAPLADAVAAATAGAGRILEVGAGTGYYLARALDAHPDAEGLASDVSPAAARR
AARAHPRAAAIVADTWAGLPVADGAVDAVLCVFAPRNPAEFARVLAPGGRVVVAVPTAEH
LAALRTRHGLLDVAGDKTDALLAGFPGWEAHVRPVRWRADLAADAVADLIAMGPNAFHGL
PEGVPAESVAAAVDVVTLVRP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcctggactggctgcgctgcccgcactgcgcggcgccgctgacccgcacgccg
ggcgcgctgcgctgcgccgccggccactcgttcgacatcgcgcggcagggctacgtcaac
ctgctgggccgggcggcgccggccaacgccgacacccccgcgatgttggaggcccgcgcc
cggttcctcgccgctggccactacgcgccgctcgccgacgcggtcgccgcggcgacggcg
ggcgcgggccggatcctggaggtgggcgccggcaccgggtactacctggcacgggccctc
gatgcgcacccggacgcggagggcctggcctccgacgtctcccccgccgccgcccggcgg
gcggcacgggcgcacccgcgggccgcggccatcgtcgccgacacctgggccggtctgccc
gtcgccgacggcgccgtcgacgcggtgctgtgcgtgttcgcgccgcgcaaccccgcggag
ttcgcccgcgtcctcgccccgggcgggcgcgtcgtcgtggccgtgcccaccgcggagcac
ctcgccgccctgcgcacccgtcacggcctgcttgacgtggcgggcgacaagacggacgcg
ctgctggcgggctttccgggttgggaggcacacgtgcggccggtgcgctggcgggccgac
ctggccgccgacgccgtggcggacctcatcgcgatgggccccaacgcgttccacggcctc
cccgaaggggtccctgcggagtccgtggcagccgccgtcgacgtggtgacgctggtacgc
ccctga

DBGET integrated database retrieval system