KEGG   Tessaracoccus flavescens: BW733_09080Help
Entry
BW733_09080       CDS       T04703                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
tfa  Tessaracoccus flavescens
Pathway
tfa00670  One carbon pool by folate
tfa01100  Metabolic pathways
tfa01120  Microbial metabolism in diverse environments
tfa01200  Carbon metabolism
Module
tfa_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:tfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BW733_09080
Enzymes [BR:tfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BW733_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: AQP50958
UniProt: A0A1Q2CXX8
Position
complement(1891884..1893545)
Genome map
AA seq 553 aa AA seqDB search
MEIAQQAIPLPISTIAERLGICAEQIEPYGRFKAKIPLNVLEARPYRREGRLVLVTAVSP
TPAGEGKTTTTVGLGDALTRLGEKAMLCLREPALGPVFGMKGGAAGGGYAQVIPMEDINL
HFTGDFPAIAAANNLLAAMIDNHIFHGNALGIDPRRVTWRRVLDVNDRTLRDIVTGLGGI
NNGLPREAGFDIVPASEVMAVFCLATSLADLRDRLGNIVIGRTYDKRPVLARNLKAHGAM
AALLRDALAPNLVQTMEHTPAFVHGGPFANIAHGTNTVIATQAALGLADWVVTEAGFGAD
LGAEKYFDIVCRRYGLRPAVSVVVTTVRAMKYHGGVEVADLTAPDVTAVRRGLVNLERHV
ETLREVFGQKVVVAINHRAEDAPDEVDTILEAAAAMGVRAVEARHFAEGGAGAEDLARAV
LEVASDDPAEPTYAYPLDGSLWDKLRDVASKVYRAKDINASAAIRRTLRQLEDEGFGELP
VCVAKTQYSFSTDPKLRGAPEGHIVDVREVRLSAGAEFVVMVCGSIMTMPGLPARPSAES
IDVLPDGSIVGLF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcacaacaggcgatcccacttcccatctcgaccatcgccgagcgcctcggc
atctgcgccgagcagatcgagccatacggccggttcaaggcgaagatcccactcaacgtc
cttgaggcgcgaccgtaccgacgcgagggccgactagtgctggtgaccgccgtctcgccg
acgcctgccggtgagggcaagacgaccaccaccgtcggccttggcgacgccttgacccgg
ctgggcgagaaggcgatgctgtgcctgcgcgagcctgccctcggaccggtgttcgggatg
aagggcggtgccgcgggcggcggctatgcccaagtgatcccgatggaggacatcaacctc
catttcaccggcgacttccccgcgatcgcggccgccaacaacctgctggccgcgatgatc
gacaaccacatcttccacggcaacgcgctcggcatcgatccacgacgggtgacctggcgc
cgcgtcctcgacgtcaacgaccggacgctgcgcgacatcgtgacggggctcggcgggatc
aacaacggcctgccccgcgaagccggcttcgacatcgtcccggcgagcgaggtgatggcc
gtgttctgcctcgccacctcgctggccgacctgcgcgaccggctcggcaacatcgtgatc
gggcgaacctacgacaagcgccccgtccttgcccgcaacctcaaggcgcacggggcgatg
gccgcgctgctgcgcgacgcgctcgccccgaacctcgtccagacgatggagcacacgccc
gcgttcgtgcacggaggaccgttcgccaacatcgcccacggcaccaacaccgtcatcgcg
acgcaggccgcgctcggcctggccgactgggtggtcacggaagccggtttcggcgccgat
ctcggcgcggagaagtacttcgacatcgtctgccgccgctacgggctacggccggcggtg
tcggtggtagtgacgacggtgcgggccatgaagtaccacggcggcgtcgaggtggccgac
ctgacggcgcccgacgtcaccgccgtccgacggggcctcgtcaacctcgagcggcacgtc
gagacgctgcgcgaggtcttcggccagaaggtcgtcgtcgcgatcaaccaccgggccgag
gatgcgcccgacgaggtcgacacaatcctcgaggccgccgccgcgatgggggtgcgcgcc
gtcgaggcgcgccacttcgccgagggtggcgccggagccgaggacctcgcccgcgcggtg
ctggaggtggcctccgacgatcccgctgagccgacctacgcctacccactcgacgggtcc
ctatgggataagctgcgcgacgtcgcctcgaaggtctaccgggcgaaggacatcaacgcg
agcgccgccatccgacgcaccctgcgccaactcgaggacgagggcttcggggagcttccg
gtctgcgtcgcgaagacgcagtactcgttctcgaccgacccgaaactgaggggcgcaccc
gagggccacatcgtcgacgtccgcgaggtgaggttgagcgcgggcgcggagttcgtggtc
atggtgtgcgggtcgatcatgacgatgcccggactcccggcccggccatcagccgagtcg
atcgatgtgctcccggacgggtccatcgtcggcctgttctga

DBGET integrated database retrieval system