KEGG   Tannerella forsythia: BFO_1524Help
Entry
BFO_1524          CDS       T01682                                 

Definition
(GenBank) peptidase family M49
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
tfo  Tannerella forsythia
Brite
KEGG Orthology (KO) [BR:tfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tfo01002]
    BFO_1524
Enzymes [BR:tfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     BFO_1524
Peptidases [BR:tfo01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   BFO_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: AEW20824
UniProt: G8ULJ6
Position
1635858..1637882
Genome map
AA seq 674 aa AA seqDB search
MFTACGNKSQTVHDEAAKQQEIDYTVDRFADIEVLRYEVPGFEALALQQKQLLYHLSEAA
LMGRDILFDQNCRYNLAIRRSLEAVYQEYKGDRNNAQFKALETYLKRVWLANGIHHHYAE
DKFEPTGLTPEFFAECIRQVDAARLPLREGQSVEQWLEEIMPVIFDPKVMPKRTVQSGEG
DILLASANNYYEGGITQKEAEDFYARMRLPNDTMAVSYGLNSRLAKVNGELVEKVWKVGG
LYTQAIERIVDELQKAVAFAENDAQRAVIEKLIEYYRTGDLKTFDAYAILWVKDLASEVD
FVNGFTETYGDPLGMKASWESITNFINREATKRTRIISENAQWFEDHSPMDKRFKKEEVK
GITAKVITVAMLGGDCYPTTPIGINLPNADWIRKHYGSKSVTIENITEAYDKAAKGNGFK
EEFVINDAERERIEQYGFITDNLHTDLHECLGHGSGQLLEGTDPNALGAYSSTLEEARAD
IFALYYLADKKLLELGLLSDPEAYKAEYYKYLMNGLMTQLVRIQSGKDIEEAHMRNRQLI
ARWAYEKGKPDNVVSFEKRDGKTFVAINDYEKLRTLFGELLAELQRIKSEGDFNAGKQLV
ETYGVKVDRALHDEVLARYQRLNLAPYKGFVNPVMKEVKNAQGEVTDITLDYTEGYIEQM
LRYSKEYSFLPTYN
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtttactgcctgcggcaacaaatcgcagactgttcatgatgaagctgcaaaacaacag
gaaatcgactacacggtcgatcgttttgccgacatcgaagtacttcgctacgaagtcccc
ggattcgaagccttggctttgcaacaaaaacagttgctttaccatctctcggaagccgcg
ttgatgggccgcgatattctttttgatcagaattgccgttacaaccttgctattcgccgc
tcgctcgaagccgtgtatcaggaatataaaggcgatcggaacaacgcgcagttcaaggcg
ctggaaacataccttaaacgcgtatggctggctaacggtatccaccatcattatgccgaa
gacaaattcgaaccgacgggtcttacgccggaattctttgcggaatgtatccgtcaggtt
gatgcggcccgcttaccccttcgcgagggacagagcgtggagcagtggcttgaagaaatc
atgccggtcatcttcgatccgaaggtgatgcccaaacggaccgtacagagcggtgaaggc
gatatccttctggcttcggcaaataattactatgagggcggcatcacacagaaagaagcg
gaagatttctatgcccgcatgcgtctcccgaacgatacgatggctgtctcctacggcctc
aacagtcggctggctaaggtaaacggcgagctcgttgaaaaagtctggaaagttggcgga
ttgtatacgcaagcgattgaacgcatcgtcgacgagttgcaaaaggccgtggcctttgcc
gagaatgacgcacagagagccgttatcgagaagctgatcgaatattaccgtacaggcgac
ctcaaaacgttcgatgcctatgccatcctctgggtgaaagaccttgcgtcggaagtagac
tttgtcaacggctttacggagacatacggcgacccgctgggcatgaaagcaagctgggag
tcgattacgaacttcatcaatcgggaagcgacgaagcgtacaagaatcatcagcgaaaac
gcgcaatggttcgaggaccattcgccgatggacaagcgttttaagaaagaagaagtaaaa
ggtatcacagcgaaagtgatcaccgtggcaatgcttggaggcgactgttacccgacaacg
ccgatcggcatcaacctgccgaatgcggactggatacgcaagcactacggctccaagtcg
gtgacgatcgagaatatcacggaggcttacgacaaagcggcgaaaggaaacggatttaag
gaggaatttgtgatcaacgatgcggaacgcgaacgaatcgagcaatacggtttcattacc
gacaacttgcataccgacctgcacgagtgcctcggacacggctcgggacagttgctcgaa
ggcacagacccgaatgcgctcggagcatacagctcgacccttgaagaggcgcgcgccgac
atttttgcgctgtactatctggccgataaaaaactgctcgaactggggctgttgagcgat
cccgaagcttacaaggcagaatattacaagtatcttatgaatggcttgatgactcagctt
gtgcgcatacagtcgggcaaagacatcgaagaggcacatatgcgaaaccggcagcttatt
gcccgctgggcttacgaaaaagggaagccggacaatgtcgtctcattcgagaaacgtgac
ggtaagacgttcgttgccattaacgactacgaaaagttgcggacgctcttcggcgagctg
ctggcggaacttcaacgcatcaagagcgaaggtgatttcaatgccggcaagcaattggtg
gaaacgtatggcgttaaagtagaccgggcccttcacgatgaggtgctggcacgctatcag
cgtctgaacctcgctccatacaaagggtttgtcaatccggtcatgaaggaggttaagaat
gcacagggcgaagtgaccgatattacgctcgattataccgaagggtatatagagcagatg
ctgcggtatagcaaagaatattcctttctgcctacatataattaa

DBGET integrated database retrieval system