KEGG   Tannerella forsythia: BFO_2558Help
Entry
BFO_2558          CDS       T01682                                 

Definition
(GenBank) methylenetetrahydrofolate reductase (NAD(P)H)
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
tfo  Tannerella forsythia
Pathway
tfo00670  One carbon pool by folate
tfo01100  Metabolic pathways
tfo01120  Microbial metabolism in diverse environments
tfo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BFO_2558
Enzymes [BR:tfo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BFO_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEW21158
UniProt: G8UL82
Position
complement(2588777..2589730)
Genome map
AA seq 317 aa AA seqDB search
METVIDLIKNSQRTAFSFEILPPLKGNSIQSVYQVIDKLREFEPKYINITSHHSEVIQRV
EPDGSIRTVNLRKRPGSVAIASAIQNKYGITAVPHLVCKGFTKDETEYGLIDLNFLGVNN
LLLLRGDIKRLDLTKDPKRCHDHATDLQHQVNDFNRGIALDGSAIEDIETLFSYGMACYP
EIHEEAPSMESDIRYAKMKVENGAEYLVTQMFFDNDKYDSFVARMRAEGVTVPIIPGIKP
IVFKDQLTVIPKIFHCTFPEPLTQALRQCKNDDEAKAVGIEWCIAQCRDLMKRGVPSIHF
YSFLASDSVRQVAKIIY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggagacagtcattgatttaataaaaaacagccaacgtacagccttctcattcgagatt
cttccgccgctgaaaggtaacagtatccaaagcgtatatcaggtcatcgataaactgagg
gaatttgagccgaaatacattaacatcacctctcatcacagcgaagtgattcagagagta
gagccggacgggtctatccggacggtcaacctccgtaaacgtcccggatcggtagctatt
gcctcggctattcagaacaaatacgggatcacggccgtgccgcacctcgtatgcaaaggc
tttacgaaagacgaaacggaatacggcctgatcgacctgaatttcctcggtgtgaacaac
ctgctgttgctgcgcggcgacatcaaacggctcgatctgacgaaggatccgaaacggtgt
cacgatcatgcaactgatctgcaacatcaggtgaatgacttcaaccgaggcatcgcactc
gacggctctgctatcgaagacatcgaaactctgttctcatacgggatggcctgttatccc
gagatacacgaagaagccccgtcgatggagtcggacatccgatacgccaaaatgaaagtg
gaaaacggagccgaatatctggtcacacaaatgttcttcgacaacgacaaatatgactct
ttcgtcgcacggatgcgtgccgaaggagtaaccgtccccatcattccgggtattaagccg
atcgttttcaaagaccagctgacagtgatcccgaagatatttcattgcacttttcccgaa
ccgctaacccaagccctccgtcagtgtaaaaacgacgatgaagccaaagccgtcggaata
gaatggtgtatcgcgcaatgtcgcgatctgatgaagcgaggcgtaccgagtatccatttc
tactcgtttctggcttccgacagcgtacggcaagtagcaaaaatcatctactga

DBGET integrated database retrieval system