KEGG   Thermobifida fusca: Tfu_0938
Entry
Tfu_0938          CDS       T00265                                 
Name
(GenBank) transcriptional regulator, LacI family
Organism
tfu  Thermobifida fusca
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_31 HTH_3
Other DBs
NCBI-ProteinID: AAZ54976
UniProt: Q47RE1
Structure
Position
1103758..1104780
AA seq 340 aa
MERRRRPTLEMVAALAGVGRGTVSRVINGSDQVSPATREAVKRAIKELGYVPNRAARTLV
TRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATGRSGIEHERLGGYL
AGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSYVDIDNIGGGRQATQ
RLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLVSYGDFTYDSGVAAMR
ELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYDDSTVAEHAEPPMTSVN
QPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagcgtcggcgacgtccgacactagagatggtggccgcgttggccggggtcggccga
ggcacggtgtctcgggtgatcaacggctctgaccaggtcagtccggccacgcgagaggcc
gtgaagcgggcgatcaaagagctgggctacgtgccgaaccgcgcagcccgcaccctggtc
acccgacgtaccgacaccgtagccctggtggtgtcggaaaacaaccagaagctcttcgcc
gaacccttctatgccgggatcgtgctcggcgtgggggttgctctgtccgaacggggattc
cagttcgtcctggccacgggccgctccgggatagagcatgagcggctgggcggctacctg
gccggacagcacgtcgacggggtcctcctgctgtcgctccaccgcgacgacccgctgccg
cagatgctggacgaggccggggtgccgtacgtctacggcggccgtccgctcggcgtcccc
gaagaacaggtgtcctatgtcgatatcgacaacatcggcgggggacgccaggccacccag
cggctgatcgagaccgggcaccggcggatcgctacgatcgcgggcccgcaggacatggtc
gctggtgtggaacgcctccaggggtatcgcgaagcactgctcgccgcggggatggagtac
gacgagacgctggtgagctacggtgacttcacctacgacagcggggtggccgcgatgcgg
gagctgctggatcgggcccccgacgtggacgccgtgttcgcggcctccgacttgatgggg
ctggccgcgctgcgggtgctgcgtgcttcgggacgccgcgtgcccgaggatgtggcggtg
gtcggctacgacgactcgaccgtagccgagcacgccgaaccgccgatgaccagcgtcaac
cagcccaccgagctgatgggccgggagatggcccggctgctcgtggaccggatcaccggg
gagaccaccgaaccggtgcggctggtgctggagacccatttgatggtgcgggaatccggg
tga

DBGET integrated database retrieval system