KEGG   Thermobifida fusca: Tfu_0276Help
Entry
Tfu_0276          CDS       T00265                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tfu  Thermobifida fusca
Pathway
tfu00071  Fatty acid degradation
tfu00280  Valine, leucine and isoleucine degradation
tfu00281  Geraniol degradation
tfu00310  Lysine degradation
tfu00360  Phenylalanine metabolism
tfu00362  Benzoate degradation
tfu00380  Tryptophan metabolism
tfu00410  beta-Alanine metabolism
tfu00627  Aminobenzoate degradation
tfu00640  Propanoate metabolism
tfu00650  Butanoate metabolism
tfu00903  Limonene and pinene degradation
tfu00930  Caprolactam degradation
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tfu_0276
   00650 Butanoate metabolism
    Tfu_0276
  Lipid metabolism
   00071 Fatty acid degradation
    Tfu_0276
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tfu_0276
   00310 Lysine degradation
    Tfu_0276
   00360 Phenylalanine metabolism
    Tfu_0276
   00380 Tryptophan metabolism
    Tfu_0276
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tfu_0276
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tfu_0276
   00281 Geraniol degradation
    Tfu_0276
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tfu_0276
   00627 Aminobenzoate degradation
    Tfu_0276
   00930 Caprolactam degradation
    Tfu_0276
Enzymes [BR:tfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tfu_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AAZ54314
UniProt: Q47TA3
Position
307663..308427
Genome map
AA seq 254 aa AA seqDB search
MADEVLYEAADGVAVITINRPQAKNAVNRAVAEQIAAALDDLDSRKDLTVGILTGAGGTF
CAGMDLKAFLAGEVPIIEGRGFGGFAQRPPRKPLIAAVEGYALAGGFEAVLACDLVVAAE
DAKFGIPEVKRGLVAAAGGLLRLPQRIPRNIAMEFALTGDFVDAPRAAELGLVNRITPSG
KALDGARELAARIAENAPLAVAVSKQVIVESADWSAAERWQRQDELTGPVFTSRDAAEGA
AAFAEKRKPVWTGE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaagttctctacgaagcggcagacggggtcgccgtcatcaccatcaaccgg
ccccaggcgaagaacgcggtgaaccgcgcggtggccgagcagatcgctgcggctttggac
gacctcgactcccgcaaggacctcacggtcgggatcctcaccggggcaggcggcaccttc
tgcgcgggaatggacctcaaagccttcctcgccggggaggtcccgatcatcgaggggcgc
gggttcggcggtttcgcccagcgtccgccgcgtaaaccgctgatcgcggcggtggaaggc
tatgcgctggccggagggtttgaagcggtgctcgcctgcgacctcgtggtcgccgccgaa
gacgcgaagttcggcatccccgaggtcaaacggggcctggtggccgccgcgggcgggctg
ctgcgcctgccgcagcgcatcccccgcaatatcgccatggagttcgcgctgaccggcgac
ttcgtggatgcgccgcgggccgctgaactggggctggtcaaccggatcacccccagtggg
aaggcgctggacggggctcgggagctcgccgcgcggatcgcggagaacgcgccgctggcc
gtcgcggtctccaagcaggtcatcgtcgagtccgcagactggtctgctgcggagcggtgg
cagcgccaggatgagctcaccggcccggtcttcaccagccgggacgcggcagaaggggcg
gcggcgttcgcggagaagcgcaagcccgtctggaccggagagtag

DBGET integrated database retrieval system