KEGG   Thermobifida fusca: Tfu_0413Help
Entry
Tfu_0413          CDS       T00265                                 

Definition
(GenBank) Delta-9 acyl-phospholipid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu01040  Biosynthesis of unsaturated fatty acids
tfu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tfu_0413
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Tfu_0413
Lipid biosynthesis proteins [BR:tfu01004]
 Desaturase
  First
   Tfu_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF3099 ThrE
Motif
Other DBs
NCBI-ProteinID: AAZ54451
UniProt: Q47SW6
Position
complement(464106..465056)
Genome map
AA seq 316 aa AA seqDB search
MSELSANSTQRRAPEPEILDEKRSRTERYTIFTFVFVPLLALAAAVPFAWGWGLTWLDVA
IGAVFYLIGGLGITVGYHRLFTHGSYRAARPLKIALAIAGSLAIEGGVIKWVADHRRHHK
YSDHEGDPHSPWRFGDDWRSVAKGMFYAHMGWLFLDEQKTSPKRFAPDLLKDKDLVRIDR
YFWVFVLISLLTPPLIGGLVTMSWWGACTAFFWGSLVRIALLHHVTWSVNSICHTIGEEN
FTVRDRSRNVWWLAIPSFGESWHNLHHAEPTCARHGVLKGQIDISARVIWIFEKLGWATK
VRWPDPERLAAKRVAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactttccgccaactcgacccagcgccgcgctccggagccagagatcctggac
gagaagcgctcccgcaccgagcgctacaccatcttcaccttcgtctttgtgccgctcctc
gccctagccgccgccgtgcccttcgcctggggatggggactgacctggctcgatgtcgct
atcggcgcggtcttctacctcatcggcgggctgggcatcaccgtgggctaccaccgcctg
ttcacccacggctcgtaccgcgccgcgcggcccctgaagatcgccctggccatcgccggc
tccctagcgatcgaaggcggggtcatcaagtgggtggccgaccaccgccgccaccacaag
tactccgaccacgaaggcgacccccactcgccttggcggttcggcgacgactggcgttcc
gtggccaaaggcatgttctacgcccacatgggctggctgttcctggacgagcagaagact
tcccctaagcggttcgcgcccgacctcctcaaagacaaggacctggtccgtatcgaccgc
tacttctgggtcttcgtgctcatctcgctgctcaccccgccgctcatcggcggcctggtg
accatgtcgtggtggggcgcgtgcaccgcgttcttctggggaagcctggtccgtatcgcg
ctcctgcaccacgtcacgtggtcggtcaactcgatctgccacaccattggtgaagaaaac
ttcacggttcgcgaccggtcccgcaacgtctggtggctggcgatcccgtccttcggcgag
tcctggcacaatctgcaccatgccgaaccgacctgcgcccggcacggggtcctcaagggc
cagatcgacatctcggcacgggtcatctggatcttcgagaaactgggatgggcgaccaag
gtgcgctggcccgaccccgagcggctggcagccaaacgtgtcgccgcctaa

DBGET integrated database retrieval system