KEGG   Thermobifida fusca: Tfu_0495Help
Entry
Tfu_0495          CDS       T00265                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tfu  Thermobifida fusca
Pathway
tfu00300  Lysine biosynthesis
tfu01100  Metabolic pathways
tfu01120  Microbial metabolism in diverse environments
tfu01230  Biosynthesis of amino acids
Module
tfu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tfu_0495
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tfu_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AAZ54533
UniProt: Q47SN4
Position
562424..563488
Genome map
AA seq 354 aa AA seqDB search
MLDLTADVRDLTARLIDIASVSGEEEPLADAVEQALRSYAHLTVLRDGNAVVARTDLGRE
RRVILAGHLDTVPIADNVPSRVVDGRLYGCGASDMKSGVAVQLKLAATLTDPVYDLTFVF
YDCEEVEAERNGLRRLVARHPDWLRGDFAVLLEPTGGQIEGGCQGTMRVEVTAQGVRAHS
ARSWMGRNAIHEAGRILDVLRAYTPRQPEVDGLRYHEGLNAVGITGGVAGNVIPDQCVVT
VNYRFAPDRTPQEAEAHLREVFDGFDVRVTDVAAGARPGLDHPTAAAFVASVGGGQARAK
LGWTDVARMAELGIPAVNYGPGDPTLAHTKDEWVDLAEIATAEQRMAAWLTGAG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgttggatctcaccgcggatgtccgtgacctcactgcacgcctcatcgacatcgcgtcg
gtgagcggggaagaggagccgctcgctgacgcggtagagcaggcgctgcggtcctatgcg
catttgactgtgctgcgggacggcaacgcggtcgtggcccgcaccgacctggggcgggag
cggcgcgtgatcctcgccgggcatctggacacggtgccgatcgccgacaacgtgccttcc
cgcgtcgtggacggcaggctctacggctgcggggcctccgacatgaagagcggggtggcg
gtccagctcaagctggccgcgaccctgaccgacccggtctacgacctcacgttcgtcttc
tacgactgcgaggaggtcgaagcggagcgcaacgggctgcgacggctcgtcgcccggcat
cccgactggctgcgcggggacttcgcggtgctgctggagcccacggggggccagatcgaa
ggcggctgccagggcaccatgcgggtggaggtgaccgcgcagggggtgcgcgcgcacagc
gcccgctcgtggatgggccgcaacgccatccacgaagccggccggatcctcgacgtgctg
cgcgcctacacgccgcgccagcccgaagtggacggactgcgctaccacgaagggctcaac
gcggtggggatcaccggcggggtggcgggcaacgtcatccccgaccagtgcgtcgtcacc
gtcaactaccggttcgcccccgaccgcaccccgcaggaagccgaagcccacctgcgggaa
gtgttcgacgggttcgacgtgcgggtgaccgacgtggcggcaggggcccgcccagggctg
gaccatcccacggcggccgcgttcgtggcctcggtcggcggcgggcaggcacgcgcgaaa
ctcgggtggaccgatgtggcgcgcatggccgagctggggattcccgcggtcaactacggt
cccggggatcccaccctcgcgcacacgaaagacgagtgggtggacttggcggagatcgcc
accgcggagcagcggatggccgcctggctgaccggggcagggtaa

DBGET integrated database retrieval system