KEGG   Thermobifida fusca: Tfu_0620Help
Entry
Tfu_0620          CDS       T00265                                 

Definition
(GenBank) cellobiohydrolase. Glycosyl Hydrolase family 6
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
tfu  Thermobifida fusca
Pathway
tfu00500  Starch and sucrose metabolism
tfu01100  Metabolic pathways
tfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tfu_0620
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tfu_0620
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     Tfu_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2
Motif
Other DBs
NCBI-ProteinID: AAZ54658
UniProt: Q47SA9
Structure
PDB: 

Position
complement(719475..721265)
Genome map
AA seq 596 aa AA seqDB search
MSKVRATNRRSWMRRGLAAASGLALGASMVAFAAPANAAGCSVDYTVNSWGTGFTANVTI
TNLGSAINGWTLEWDFPGNQQVTNLWNGTYTQSGQHVSVSNAPYNASIPANGTVEFGFNG
SYSGSNDIPSSFKLNGVTCDGSDDPDPEPSPSPSPSPSPTDPDEPGGPTNPPTNPGEKVD
NPFEGAKLYVNPVWSAKAAAEPGGSAVANESTAVWLDRIGAIEGNDSPTTGSMGLRDHLE
EAVRQSGGDPLTIQVVIYNLPGRDCAALASNGELGPDELDRYKSEYIDPIADIMWDFADY
ENLRIVAIIEIDSLPNLVTNVGGNGGTELCAYMKQNGGYVNGVGYALRKLGEIPNVYNYI
DAAHHGWIGWDSNFGPSVDIFYEAANASGSTVDYVHGFISNTANYSATVEPYLDVNGTVN
GQLIRQSKWVDWNQYVDELSFVQDLRQALIAKGFRSDIGMLIDTSRNGWGGPNRPTGPSS
STDLNTYVDESRIDRRIHPGNWCNQAGAGLGERPTVNPAPGVDAYVWVKPPGESDGASEE
IPNDEGKGFDRMCDPTYQGNARNGNNPSGALPNAPISGHWFSAQFRELLANAYPPL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagttcgtgccacgaacagacgttcgtggatgcggcgcggcctggcagccgcc
tctggactggcgcttggcgcctccatggtggcgttcgctgctccggccaacgccgccggc
tgctcggtggactacacggtcaactcctggggtaccgggttcaccgccaacgtcaccatc
accaacctcggcagtgcgatcaacggctggaccctggagtgggacttccccggcaaccag
caggtgaccaacctgtggaacgggacctacacccagtccgggcagcacgtgtcggtcagc
aacgccccgtacaacgcctccatcccggccaacggaacggttgagttcgggttcaacggc
tcctactcgggcagcaacgacatcccctcctccttcaagctgaacggggttacctgcgac
ggctcggacgaccccgaccccgagcccagcccctcccccagcccttcccccagccccaca
gacccggatgagccgggcggcccgaccaacccgcccaccaaccccggcgagaaggtcgac
aacccgttcgagggcgccaagctgtacgtgaacccggtctggtcggccaaggccgccgct
gagccgggcggttccgcggtcgccaacgagtccaccgctgtctggctggaccgtatcggc
gccatcgagggcaacgacagcccgaccaccggctccatgggtctgcgcgaccacctggag
gaggccgtccgccagtccggtggcgacccgctgaccatccaggtcgtcatctacaacctg
cccggccgcgactgcgccgcgctggcctccaacggtgagctgggtcccgatgaactcgac
cgctacaagagcgagtacatcgacccgatcgccgacatcatgtgggacttcgcagactac
gagaacctgcggatcgtcgccatcatcgagatcgactccctgcccaacctcgtcaccaac
gtgggcgggaacggcggcaccgagctctgcgcctacatgaagcagaacggcggctacgtc
aacggtgtcggctacgccctccgcaagctgggcgagatcccgaacgtctacaactacatc
gacgccgcccaccacggctggatcggctgggactccaacttcggcccctcggtggacatc
ttctacgaggccgccaacgcctccggctccaccgtggactacgtgcacggcttcatctcc
aacacggccaactactcggccactgtggagccgtacctggacgtcaacggcaccgttaac
ggccagctcatccgccagtccaagtgggttgactggaaccagtacgtcgacgagctctcc
ttcgtccaggacctgcgtcaggccctgatcgccaagggcttccggtccgacatcggtatg
ctcatcgacacctcccgcaacggctggggtggcccgaaccgtccgaccggaccgagctcc
tccaccgacctcaacacctacgttgacgagagccgtatcgaccgccgtatccaccccggt
aactggtgcaaccaggccggtgcgggcctcggcgagcggcccacggtcaacccggctccc
ggtgttgacgcctacgtctgggtgaagcccccgggtgagtccgacggcgccagcgaggag
atcccgaacgacgagggcaagggcttcgaccgcatgtgcgacccgacctaccagggcaac
gcccgcaacggcaacaacccctcgggtgcgctgcccaacgcccccatctccggccactgg
ttctctgcccagttccgcgagctgctggccaacgcctacccgcctctgtaa

DBGET integrated database retrieval system