KEGG   Thermobifida fusca: Tfu_0943Help
Entry
Tfu_0943          CDS       T00265                                 

Definition
(GenBank) putative ATP/GTP-binding protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_1 GTP_EFTU AAA_24 Ras MMR_HSR1 T2SSE Roc NTPase_1
Motif
Other DBs
NCBI-ProteinID: AAZ54981
UniProt: Q47RD6
Position
1110764..1111351
Genome map
AA seq 195 aa AA seqDB search
MTSVKIVVAGGFGVGKTTFVGSVSEIVPLTTEAVMTSASVGVDDLAKTPDKQTTTVAMDF
GRVSLDSDLILYLFGTPGQHRFWFMWDDLVKGAIGAVVLVDTRRLADCFPAIDYFEEAKL
PFIVAINGFDSYFPHSISEVRDALTLSEDIPIVQCDARDRASTKATLIRLVEHAIAVGDA
SAEQTTPTGGHPSWR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggtgaagatcgtcgtcgccgggggcttcggcgtcgggaagacgacgtttgtg
gggtcggtctctgagatcgttccactgaccaccgaagcggtgatgactagcgccagcgtc
ggagtcgacgacttggcgaaaacaccggacaagcagacgaccacagtcgccatggacttc
ggtcgggtgtccctcgactccgacctcatcctctacctgttcggtacccccgggcagcac
cgcttctggttcatgtgggatgacttggtcaaaggagccatcggcgcggtggtcctggtg
gacacccgccgcctggcggactgcttcccggccatcgactacttcgaagaagcgaagctg
ccgttcatcgtcgcaatcaacggtttcgactcttacttcccccactcgatcagcgaggtg
cgggacgccttgacgctcagcgaggacattccgatcgtgcagtgcgacgcccgggaccgg
gcgtccaccaaggcgacgctgatccgcctggtggagcacgcgatcgcggtcggggacgcc
tccgcggagcagactacccccacgggcggccacccctcctggcggtag

DBGET integrated database retrieval system