KEGG   Thermobifida fusca: Tfu_0944Help
Entry
Tfu_0944          CDS       T00265                                 

Definition
(GenBank) similar to 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol methylase
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 NodS CMAS PrmA MetW NNMT_PNMT_TEMT Methyltransf_29 Pox_MCEL Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: AAZ54982
UniProt: Q47RD5
Position
1111462..1112253
Genome map
AA seq 263 aa AA seqDB search
MTFHDERRAFWEERLDADWTETGVGYRALGRSFNEWMYRVRQEVFAERVGALAVDWSRAR
VLDVGSGTGFYVRAWQRLGAVAVTGCDLTEAAVVRLRERFPGLRFERVDIADPQGVFDEA
EFDAVSCMDVLFHITDDERYAAAVKSIAHLVRSGGYFVFSENFLHRPAQRGVNQVNRPLE
WITARLDEAGFDVVHRSPFLMLMNAQVDAGPVWRKLWGGLLRAVTLTEPTGWLAGAALYP
LERHLVRTRMESPTTEIMICRRR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgactttccacgatgaacgcagggctttctgggaggagcgcctcgacgcggactggacg
gagaccggggtcggctaccgggctttgggtcggtcgttcaacgagtggatgtaccgggtg
cgccaggaggtgttcgcggagcgggtgggggcgctcgccgtggactggtctcgggcgcgg
gtgttggacgtgggctcggggaccgggttctatgtccgcgcctggcagcggttgggcgcg
gtcgcggtcactggctgcgatttgacggaggccgcggtggtgcggctgcgggagcggttt
ccggggctgcggttcgaacgggtggatatcgccgacccgcagggggtgttcgacgaggct
gagttcgacgcggtctcctgtatggacgtgctgttccatatcacggacgacgagcgttac
gcggccgcggtgaagtcgatcgcccacctggtgcggtctggcgggtatttcgtgttctcg
gagaatttcctgcaccgtccggcccagcgcggcgtcaaccaggtcaaccgtccgttggag
tggatcactgcccggttggatgaggccgggttcgacgtggtgcaccggtcgccgttcctc
atgctcatgaacgcgcaggtggatgcggggccggtgtggcgcaagctgtggggcggcctg
ctgcgcgcggtgacgctcaccgagccgacggggtggctggccggggcggcgctctacccg
ttggagcggcatttggtgcgcacgcggatggagagcccgaccacggagatcatgatctgc
cgccgccgatga

DBGET integrated database retrieval system