KEGG   Thermobifida fusca: Tfu_0946Help
Entry
Tfu_0946          CDS       T00265                                 

Definition
(GenBank) butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00071  Fatty acid degradation
tfu00280  Valine, leucine and isoleucine degradation
tfu00650  Butanoate metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01200  Carbon metabolism
tfu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Tfu_0946
  Lipid metabolism
   00071 Fatty acid degradation
    Tfu_0946
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tfu_0946
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Tfu_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: AAZ54984
UniProt: Q47RD3
Position
complement(1112904..1114058)
Genome map
AA seq 384 aa AA seqDB search
MSYRLSDEHEELRRTVAEFARTEVAPVIGDYYERAAFPYEIVAAMGRMGLFGLPFPEDVG
GMGGDYLALCLALEELARVDSSVAITLEAAVSLGAMPIYRFGTPEQQATWLPRLCSGEAL
GAFGLTEPEGGSDAGATRTTARLDAGEWVINGTKSFITNSGTDITALVTVTAVTGQRPDG
RPEISAIIVPAGTPGFTIGQRYSKVGWCASDTNELVFTDCRVPEANLLGERGRGYAQFLS
ILDEGRIAIAALAVGLAQGCVDECLRYVGQRVAFGREIGRYQAIQFKIADMAARVHTARL
AYYDAAARLLAGQPFKKEAAIAKLVASHAAMDNARDATQIFGGYGFMNEYPVGRFYRDAK
ILEIGEGTSEIQRMVIARELGLPA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccgtctcagcgacgaacacgaagaactgcgccgcaccgtcgccgaattcgcc
cgcaccgaagtcgcgcctgtcatcggcgactactacgaacgcgccgccttcccctacgag
atcgtcgccgccatggggcgcatgggcctgttcggcctgccgttccccgaagacgtcggc
ggcatgggcggcgactacctggcgctctgcctcgccctggaagaactcgcccgcgtcgac
tcgtccgtcgccatcaccctggaagccgccgtctccctcggcgcaatgccgatctaccgg
ttcggcacccctgaacagcaagccacctggctgccccggctctgctccggagaagccctc
ggcgcgttcggcctcaccgaacccgaaggcggctccgatgcgggcgccacccgcaccacc
gcccgcctcgatgccggagaatgggtcatcaacggcaccaaaagcttcatcaccaactcc
ggcaccgacatcaccgcgctcgtcaccgtcaccgcggtcaccggacaacggcccgacgga
cgccccgaaatctccgcgatcatcgtccccgccggcactcccggcttcactattggccag
cggtactccaaagtcggctggtgcgcctccgacaccaacgaactcgtgttcaccgactgc
cgggtccctgaagccaacctcctcggcgaacgcggccgcggctacgcccaattcctgagt
atcctcgacgaaggccgcatcgctatcgccgcgctcgccgtcggactcgcccaaggctgc
gtcgacgaatgcctgcgctacgtcggccagcgcgtcgccttcggccgcgaaatcggccgc
taccaggcgatccaattcaagatcgcggacatggccgcccgcgtgcacaccgcccggctc
gcctactacgacgcggccgcacgcctgctggccgggcagccgttcaaaaaagaagccgcc
atcgccaaactcgtcgcgtcccacgcggccatggacaacgcccgcgacgccacccagatc
ttcgggggctacgggttcatgaacgaatacccggtcggacgcttctaccgcgacgccaaa
atcctcgaaatcggcgaaggcacctcagaaatccagcggatggtcatcgcccgggaactc
ggactgcccgcctag

DBGET integrated database retrieval system